KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_312743Help
Entry
ARALYDRAFT_312743 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:aly00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 978 aa AA seqDB search
MDTSIPIEAIPLASFIPDLVDDQTRNTSTIPTMTSPLHITIMPFDDVNDETHKTSATSPP
IMVSPLRTIWPSNKDWYDGDAGPSTGPIKREPFDDETHNLSAHPPEMVTPLNTIRPIDDS
NNNSNDAGVGLSTVPAKRGRGRPKGSKNSTSTERKKTKVYDPNSLRVTTFLGNFDSEITD
AERENGNQELADSVMMRFDAVRRRLCQLNPTEDILVTANTNFTKFGVKTNTRRRIGPVPG
VQVGDIFYFWGEMCLVGLHRQMVGGIDFLTAAESVVEGHAATSVVTAGQYDDETDGLESL
IYCGQGGSDKSGRVFDQELKGGNLALKASVSKGNDVRVVRGVMHPFDNNQKVYIYDGIYL
VTESWTVTGKSGFMEFRFKLVRKPNQPSGYAIWKLVENLRDNDLIDSRPGFILRDLSFGA
ELLRVPLVNEVDEDDKTIPEDFDYITSQCHSGMTFDLQSLGCQNFQHQSCIDQNSTCKQR
NGGLLPYHNNILVCRKPLIYECGGSCPCPNNCPTRLVQTGLKLQLEVFKTRNCGWGLRSW
DPIRAGTFICEFAGVRKTTKEEVEEDDDYLFDTSKIYPRFKWNYEPELLLGDCWEQVSEF
INLPTQVLISAKENGNVGRFMNHSCSPNVFWQPIEYENNGDIYILIGLFAMKHIPPMTEL
TYDYGVSRVERTEEDEKGFLVCPYLSFVPLAIFLGNSLSFHVIRFSDSKGRAWYDKIKIY
RKSDSLASQGKVSLESSDSSGLDSVKDEPEKLTEEQMEGERFKEKLSDSVLIDEKLEEYS
DCDQTATTSPCPKDPVSSQSTHRSPESFVTAITCDDDTFVSVSGISRGVSNLIPFATETQ
ASPVQDKVASTRSYGSNSMKVNNQDEFFIEDFDVGPMDTIDLYDMTFREDPSDFDDNLLY
ATRDRTKQLRSFKRKIMDAITSKRRREKEYEQLSIWFGDADMGCDLVNTKEHATTSLDSK
SSQSNVPFVSQDSEWELL
NT seq 2937 nt NT seq  +upstreamnt  +downstreamnt
atggatacgtctattccaatcgaggcaataccgctcgcaagtttcataccggatttggta
gatgaccagaccagaaacacatcaacgattccgacaatgacgtcaccgcttcatataacc
attatgccatttgacgatgtcaatgatgaaacccacaagacatctgcaacatctcctcct
ataatggtctcacctctgcgaaccatctggccatccaacaaggactggtatgatggagat
gctggtcctagtactggtccaatcaaacgagaaccgttcgatgatgaaacgcacaactta
tccgcacacccacctgaaatggtgactccactgaacaccattaggccaattgatgactct
aacaacaattctaatgatgcgggtgttggtcttagcactgttccagcaaaacgaggacgt
ggccgaccaaaaggttcaaaaaactcaacgtcgaccgagcggaagaagacaaaagtatat
gatcccaacagcttaagggttacaacttttcttgggaattttgattcagagataaccgac
gcagagagagaaaatggaaaccaagagttagctgattcagtaatgatgcggtttgatgcg
gttagacgccgattatgccaactaaaccctacggaagacatccttgtaacggctaatacg
aatttcacgaaatttggggtcaagacaaatacgagaaggagaataggtccagttcctgga
gtacaagtaggagatatattctacttctggggtgaaatgtgcttagtggggcttcacaga
caaatggtcggcggcattgattttctgacggctgcagagagtgtagtggaaggtcatgct
gcaacgagtgtggtcacagcaggacaatacgatgatgaaaccgatgggcttgaatcgttg
atctattgcggacagggtggatcggacaagtccggtcgtgtttttgatcaagagctgaaa
gggggaaatcttgcactgaaagcaagtgtaagcaaagggaatgacgttagagtcgtgagg
ggagtgatgcatccttttgacaacaatcagaaggtatatatctatgatgggatttatctg
gttacagagtcctggacagtgacaggaaaatccggtttcatggagttcagattcaaattg
gtaaggaaaccaaaccaaccttctggttatgcaatctggaaattagttgaaaatttgagg
gacaatgacttgattgattcaaggccaggttttatccttagagatctttcttttggagct
gagcttttacgagttccgcttgttaatgaagtcgatgaagacgacaaaacgattcccgaa
gattttgactacatcacatctcagtgtcactctggtatgacgtttgatcttcaatcactt
ggatgccaaaattttcaacatcagtcatgcattgatcaaaacagcacctgcaagcagaga
aacggtggcctactaccgtaccataacaacattttggtttgtcgtaaaccgttgatttac
gagtgcggtggttcttgtccatgccctaacaattgcccaaccaggttggttcaaaccggc
ttgaaactccagttggaagtgttcaagacaagaaactgtggttggggtttacgttcttgg
gatccaattcgagctggaacttttatctgcgagtttgccggtgtgagaaagacgacgaaa
gaagaagtagaagaggatgatgattacttgttcgacacgtctaagatttatcccaggttt
aaatggaactacgaacctgagcttttgcttggagattgttgggagcaagtctcagaattt
atcaatcttccaacacaagtcttgataagcgccaaggaaaacggaaatgttggtcggttc
atgaaccacagctgttcaccgaatgttttctggcagcctatagagtatgaaaacaacggt
gatatatatattcttattggactttttgctatgaagcatattcctccaatgacagagtta
acatatgactatggagtttctcgtgtggagaggaccgaagaagatgaaaagggttttctt
gtctgcccttacctttctttcgtccctctggccatcttcctcggaaattcactttcattt
catgtaattcgattctcagattctaaaggaagagcatggtatgataaaattaaaatctac
cgtaaatcggacagtttggcttctcagggtaaggtttctttagaatcaagtgattcttca
ggattggattctgtaaaggatgaaccagagaaacttacagaggaacaaatggagggagag
cgttttaaggagaagttatcagactctgttttgattgatgagaagcttgaagagtacagt
gattgtgatcagacagcaaccacttccccttgccccaaagatccagtatcttctcaatct
actcaccgctccccggaaagctttgtgactgcaataacatgtgatgatgatacttttgta
tctgtctctgggatttctaggggtgtttcaaatctaatcccattcgctacagagactcaa
gcttcacctgttcaagacaaagtggcaagcactagatcctatggcagcaactctatgaaa
gttaataatcaagatgagttcttcattgaagacttcgatgttggtccaatggataccatt
gatttgtatgacatgacatttcgagaagacccctcagattttgacgacaatttgctatat
gcaacgcgtgacaggactaagcaactaagatcattcaagagaaagataatggatgctata
acttcgaaaagaagaagagagaaggaatatgagcagctttctatatggttcggagacgca
gacatgggttgtgatctggtaaacactaaggaacatgctacaacatctctagactccaaa
agctcacagtcaaatgtgccatttgtatcacaagattctgagtgggagcttttgtaa

DBGET integrated database retrieval system