KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_314969Help
Entry
ARALYDRAFT_314969 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ARALYDRAFT_314969
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ARALYDRAFT_314969
  Lipid metabolism
   00071 Fatty acid degradation
    ARALYDRAFT_314969
  Amino acid metabolism
   00350 Tyrosine metabolism
    ARALYDRAFT_314969
Enzymes [BR:aly01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ARALYDRAFT_314969
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 387 aa AA seqDB search
METQGKVITCRAAVAWGAGEPLVMEDVKVDPPQRLEVRLRILFTSICHTDLSAWKGENES
QRAYPRILGHEAAGIVESVGEGVEEMKAGDHVLPIFTGECGDCRVCKQDEANLCERFRVD
PMKKVMVTDGKTRFFTSKDNKPIYHFLNTSTFSEYTVIDSACVLKVNPLFPLEKISLLSC
GVSTDKCLWNEGVGAAWNVADIQPGSTVAIFGLGAVGLAVAEGARVRGASKIIGIDVNPD
KFPLGREAGISEFINPKESDKAVHERVREITEGGVECSFECAGSIEALREAFLSTNSGVG
VTVLLGVHASPQLLPIHPMELFQGRSITASVFGGFKPKTQLPFLITQCLQGLLNLDLFIS
HQLPFHDINKAMQLLHQGKAIRCLLRL
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggaaacacaaggcaaagtaatcacttgcagagctgctgtggcatggggagctggagaa
cctctagtgatggaagatgtaaaagtggatcctcctcaaagattggaagtgagacttcga
atcctcttcacttccatctgtcacactgatcttagcgcatggaaaggcgagaacgagtct
cagcgagcataccctcgaatccttggccatgaggcggcagggatagtggagagcgtaggg
gaaggagtggaagagatgaaggcaggagatcatgtgctccctattttcacaggagagtgt
ggagattgcagagtctgcaagcaagacgaagccaatctgtgcgagagattccgagtagat
ccgatgaagaaggtgatggtaaccgatggaaagaccagattcttcacaagcaaagacaac
aaacccatctaccattttctcaacacatccaccttctccgagtacacggtcatagactcg
gcttgcgtgctcaaggtgaaccctctgtttcctctggagaagataagcctcctcagctgc
ggtgtctccactgataagtgtttatggaatgaaggagtcggtgcggcgtggaatgtggct
gatattcaacctggctccaccgtcgctatatttggacttggcgctgttggacttgccgtg
gctgaaggtgcaagagtcaggggagcctctaaaatcattgggatcgacgtcaaccctgac
aagttcccattaggcagagaagcagggatcagtgaattcataaatccaaaggagagtgac
aaggcagttcatgagagagtaagggagataacagagggaggagtggagtgcagctttgag
tgtgcgggaagcatagaagcacttagagaagcctttctgtctactaactcaggagtggga
gtgacagtgttgctgggcgttcacgcaagcccacagcttcttcctatccatcccatggag
ctcttccaaggcagatccatcaccgcctctgttttcggaggcttcaaacccaaaacccaa
ttaccctttctcatcacccaatgcctccaaggtcttctcaatctcgatctcttcatctct
caccagcttccattccacgatatcaacaaagccatgcagctgcttcaccaaggcaaagct
attcgttgccttctccgcctctga

DBGET integrated database retrieval system