KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_316241Help
Entry
ARALYDRAFT_316241 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00260  Glycine, serine and threonine metabolism
aly00750  Vitamin B6 metabolism
aly01100  Metabolic pathways
aly01110  Biosynthesis of secondary metabolites
aly01230  Biosynthesis of amino acids
Module
aly_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ARALYDRAFT_316241
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ARALYDRAFT_316241
Enzymes [BR:aly01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ARALYDRAFT_316241
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PALP OKR_DC_1_N
Motif
Other DBs
NCBI-GeneID: 9323518
NCBI-ProteinID: XP_002888893
UniProt: D7KR40
Position
Unknown
AA seq 519 aa AA seqDB search
MASFSLLHSATYFPSHSETSLKPYSAASFTVRCTSSASASPAVPPQTPEKHRRSPDENIR
DEARRRPHQLQNLSARYVPFNAPPSSTESYSLDEIVYRSQSGGLLDVQHDFAALKRYDGE
FWRNLFDSRVGKTNWPYGSGVWSKKEWVLPEIDDDDIVSAFEGNSNLFWAERFGKQYLQM
NDLWVKHCGITHTGSFKDLGMTVLVSQVNRLRKMNKPVIGVGCASTGDTSAALSAYCASA
GIPSIVFLPADKISMAQLVQPIANGAFVLSIDTDFDGCMHLIREVTAELPIYLANSLNSL
RLEGQKTAAIEILQQFNWQVPDWVIVPGGNLGNIYAFYKGFDMCKELGLVDRIPRLVCAQ
AANANPLYLHYKSGFKEDFNPLKANTTFASAIQIGDPVSIDRAVYALKKSNGIVEEATEE
ELMDATALADSTGMFICPHTGVALTALMKLRKSGVIEANDRTVVVSTAHGLKFTQSKIDY
HSKNIKEMACRLANPPVKVKAKFGSVMDVLKEYLKSNDK
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggcctcattctctcttctccactccgccacctactttccttcccactctgaaacctca
cttaaaccttactccgccgcttccttcaccgtccgctgcacctcctccgcctccgcctct
cccgccgttcctccacaaactccggagaaacaccgccgttcccctgatgagaacattcga
gacgaagctcgtcgccgtcctcatcaactccaaaacctctccgcacgctacgtccctttc
aacgctccaccttcttcaaccgaatcctactccctcgacgagatcgtctaccgttcacaa
tccggtggtctcctcgacgtccaacacgatttcgccgccttgaaacgctacgacggagaa
ttctggcgtaacctcttcgattctcgcgtcggtaaaaccaattggccgtacggatcaggc
gtttggtcgaagaaagagtgggttcttcctgagattgacgatgacgacatcgtttctgct
ttcgaaggaaactcaaatctcttctgggctgagagatttggtaaacagtatctgcaaatg
aacgatctttgggtgaaacattgtggaatcacccacactggttcctttaaagatctgggc
atgactgttcttgtttctcaggtgaatcgtctccggaaaatgaacaaaccagtcatcgga
gttggatgcgcttctactggagatacctccgctgctctctctgcttactgtgcttccgct
ggaatcccgtcgatcgttttcttaccagcggataaaatctccatggctcagcttgttcag
ccgattgctaatggggcttttgtgcttagtattgatactgatttcgatggatgtatgcat
ttgatcagagaagtaacggcggagcttccgatttacttagccaactctctcaacagcctc
cgtctcgaaggacaaaagacagcggcgattgagattttgcagcagtttaattggcaagtt
cctgattgggtcattgttcctggaggcaatcttggtaacatctatgcgttttacaaaggg
tttgatatgtgtaaagagttaggtcttgttgatagaatccctagacttgtgtgtgctcaa
gctgctaacgctaatccactttacttgcactacaaatctgggtttaaagaagacttcaat
ccattgaaagcaaacactacatttgcttctgcgattcagatcggcgaccctgtttcgatt
gatagagctgtttatgcgttgaagaaatctaatggaattgttgaggaagctacagaagaa
gagttgatggatgcaacagctcttgctgattctactggtatgtttatatgtccacataca
ggtgttgcattgacggcgttgatgaagctgaggaagtctggagttatcgaagcgaatgat
cggactgtggtggtgagtacagctcatggattgaagtttacacagagtaagattgattat
cattctaagaacataaaagagatggcttgtagattggcgaatccaccagtgaaggtcaag
gcaaagtttggttcagttatggatgttctcaaggagtatttgaagagcaatgataaataa

DBGET integrated database retrieval system