KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_316241Help
Entry
ARALYDRAFT_316241 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ARALYDRAFT_316241
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ARALYDRAFT_316241
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ARALYDRAFT_316241
Enzymes [BR:aly01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ARALYDRAFT_316241
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 519 aa AA seqDB search
MASFSLLHSATYFPSHSETSLKPYSAASFTVRCTSSASASPAVPPQTPEKHRRSPDENIR
DEARRRPHQLQNLSARYVPFNAPPSSTESYSLDEIVYRSQSGGLLDVQHDFAALKRYDGE
FWRNLFDSRVGKTNWPYGSGVWSKKEWVLPEIDDDDIVSAFEGNSNLFWAERFGKQYLQM
NDLWVKHCGITHTGSFKDLGMTVLVSQVNRLRKMNKPVIGVGCASTGDTSAALSAYCASA
GIPSIVFLPADKISMAQLVQPIANGAFVLSIDTDFDGCMHLIREVTAELPIYLANSLNSL
RLEGQKTAAIEILQQFNWQVPDWVIVPGGNLGNIYAFYKGFDMCKELGLVDRIPRLVCAQ
AANANPLYLHYKSGFKEDFNPLKANTTFASAIQIGDPVSIDRAVYALKKSNGIVEEATEE
ELMDATALADSTGMFICPHTGVALTALMKLRKSGVIEANDRTVVVSTAHGLKFTQSKIDY
HSKNIKEMACRLANPPVKVKAKFGSVMDVLKEYLKSNDK
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggcctcattctctcttctccactccgccacctactttccttcccactctgaaacctca
cttaaaccttactccgccgcttccttcaccgtccgctgcacctcctccgcctccgcctct
cccgccgttcctccacaaactccggagaaacaccgccgttcccctgatgagaacattcga
gacgaagctcgtcgccgtcctcatcaactccaaaacctctccgcacgctacgtccctttc
aacgctccaccttcttcaaccgaatcctactccctcgacgagatcgtctaccgttcacaa
tccggtggtctcctcgacgtccaacacgatttcgccgccttgaaacgctacgacggagaa
ttctggcgtaacctcttcgattctcgcgtcggtaaaaccaattggccgtacggatcaggc
gtttggtcgaagaaagagtgggttcttcctgagattgacgatgacgacatcgtttctgct
ttcgaaggaaactcaaatctcttctgggctgagagatttggtaaacagtatctgcaaatg
aacgatctttgggtgaaacattgtggaatcacccacactggttcctttaaagatctgggc
atgactgttcttgtttctcaggtgaatcgtctccggaaaatgaacaaaccagtcatcgga
gttggatgcgcttctactggagatacctccgctgctctctctgcttactgtgcttccgct
ggaatcccgtcgatcgttttcttaccagcggataaaatctccatggctcagcttgttcag
ccgattgctaatggggcttttgtgcttagtattgatactgatttcgatggatgtatgcat
ttgatcagagaagtaacggcggagcttccgatttacttagccaactctctcaacagcctc
cgtctcgaaggacaaaagacagcggcgattgagattttgcagcagtttaattggcaagtt
cctgattgggtcattgttcctggaggcaatcttggtaacatctatgcgttttacaaaggg
tttgatatgtgtaaagagttaggtcttgttgatagaatccctagacttgtgtgtgctcaa
gctgctaacgctaatccactttacttgcactacaaatctgggtttaaagaagacttcaat
ccattgaaagcaaacactacatttgcttctgcgattcagatcggcgaccctgtttcgatt
gatagagctgtttatgcgttgaagaaatctaatggaattgttgaggaagctacagaagaa
gagttgatggatgcaacagctcttgctgattctactggtatgtttatatgtccacataca
ggtgttgcattgacggcgttgatgaagctgaggaagtctggagttatcgaagcgaatgat
cggactgtggtggtgagtacagctcatggattgaagtttacacagagtaagattgattat
cattctaagaacataaaagagatggcttgtagattggcgaatccaccagtgaaggtcaag
gcaaagtttggttcagttatggatgttctcaaggagtatttgaagagcaatgataaataa

DBGET integrated database retrieval system