KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_316714Help
Entry
ARALYDRAFT_316714 CDS       T01578                                 

Definition
phosphoglycerate/bisphosphoglycerate mutase family protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ARALYDRAFT_316714
   01230 Biosynthesis of amino acids
    ARALYDRAFT_316714
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ARALYDRAFT_316714
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ARALYDRAFT_316714
Enzymes [BR:aly01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ARALYDRAFT_316714
Exosome [BR:aly04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ARALYDRAFT_316714
  Exosomal proteins of melanoma cells
   ARALYDRAFT_316714
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 332 aa AA seqDB search
MATTTTMSHQAIGSIVSHRPFKASQFLKEPLNVPMKFRPKRFKIEATASQISVVDNTFLS
PTKNRPQVSKKKSNEAALILIRHGESLWNEKNLFTGCVDVPLTQKGVGEAIEAGKKISNI
PVDLIFTSSLIRAQMTAMLAMTQHRRKKVPIILHNESVKAKTWSHVFSEETRKQSIPVIA
AWQLNERMYGELQGLNKKETAERYGTQQVHEWRRSYEIPPPKGESLEMCAERAVAYFEDN
IKPELASGNNVMIAAHGNSLRSIIMYLDDLTSQEVTTLDLSTGVPLLYIFKEGKFMKRGS
PVGPTEAGVYAYTKRLAQYREKLDAASQATLD
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggctactacgacgactatgtctcatcaagcgatcgggtctattgtctctcatagacca
tttaaagcttctcagtttctgaaggagcctttgaatgttccaatgaaattcagaccaaaa
agattcaagattgaagcaactgcgtctcagatttctgtcgttgacaacactttcttgtct
cctaccaagaacagacctcaagtatccaaaaagaaatcaaatgaagcagctttgatattg
attaggcatggagagtcgttatggaatgagaagaatttgtttacgggttgtgttgatgtg
ccattgactcagaaaggtgtgggagaagctattgaagctgggaagaagattagtaacata
cctgtagatttgatcttcacatcatctttaatccgtgctcagatgaccgcaatgcttgcc
atgactcagcatcgtcgcaagaaggttccaatcatcttgcacaatgagagtgtaaaggcg
aaaacttggagtcatgtgttcagtgaagaaactagaaaacaatctatcccggttatagcg
gcttggcagctgaatgagagaatgtatggagaattgcagggtttgaacaagaaagaaaca
gccgaaagatatgggacacaacaagttcacgaatggcgtaggagttacgaaattcctccc
ccgaaaggcgagagcttggagatgtgcgctgagagagcagtggcttattttgaagacaat
atcaaaccagagcttgcatctggaaacaatgtaatgattgctgctcacgggaactcattg
cgatctatcattatgtatctggacgatttaacttctcaggaggttacaactctagactta
tccacgggtgtaccattgctctacatcttcaaagaaggcaagttcatgaaacgaggcagc
ccggtcggtcctactgaagctggtgtctatgcttatacaaagagattggcacaatacaga
gagaagcttgatgcggcgagtcaggcgacccttgactaa

DBGET integrated database retrieval system