KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_321348Help
Entry
ARALYDRAFT_321348 CDS       T01578                                 

Definition
SBE2.1
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ARALYDRAFT_321348
Enzymes [BR:aly01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     ARALYDRAFT_321348
Exosome [BR:aly04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ARALYDRAFT_321348
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 829 aa AA seqDB search
MVYTISGVRFPHLPSIKKNSSLPSFNEDLRRTNAVSFSLRKDSRSSGKLPLHLRSFVAIR
YNLGKLSLTILSFVVLGDVDTQKTEESQETDKTCALSTSGSKSYKEDIAEMSQSLDQEVG
QRKIPPPGDGKKIYDIDPMLNSHRTHLDYRYGQYRKLREEIDKYEGGLEAFSRGYEIFGF
TRSATGITYREWAPGAKAASLIGDFNNWNAKADVMARNDFGVWEIFLPNNADGSSAIPHG
SRVKIRMDTPSGIKDSIPAWIKYSVQPPGEIPYNGVYYDPAVEDKYVFKHPRPRRPTSLR
IYESHVGMSSTEPKINTYANFRDDVLPRIKKLGYNAVQIMAIQEHAYYASFGYHVTNFFA
PSSRFGTPDDLKSLIDKAHELGLVVLMDIVHSHASKNTLDGLDMFDGTDGQYFHSGSRGY
HWMWDSRLFNYGSWEVLRYLLSNARWWLEEYKFDGFRFDGVTSMMYTHHGLQVEFTGNYN
EYFGYSTDVDAVVYLMLVNDLIHGLYPEAIVVGEDVSGMPAFCIPVEDGGVGFDYRLHMA
VADKWIELLKKRDEDWQVGDITFTLTNRRWGEKCVVYAESHDQALVGDKTIAFWLMDKDM
YDFMAVDRQATPRVDRGIALHKMIRLITMGLGGEGYLNFMGNEFGHPEWIDFPRTDQHLP
DGRVIPGNNGSYDKCRRRFDLGDAEYLRYHGLQEFDRAMQNLEETYGFMTSEHQYISRKD
EGDKVIVFERGNLLFVFNFHWTNSYSDYRIGCSVPGKYKIVLDSDNSLFGGFNRLDDSAE
FFTSDGRHDDRPCSFMVYAPCRTAVVYAAVDDDDDRSSLVPISLLPEDV
NT seq 2490 nt NT seq  +upstreamnt  +downstreamnt
atggtttacacgatttccggcgtacgtttcccacatcttccatcgattaagaagaactcg
tctcttcccagtttcaatgaagatctcaggagaaccaacgctgtttccttctctctgagg
aaggactctcgttcttctgggaagctaccactgcatctgagaagcttcgtggccatcaga
tacaatctcgggaaactgtctctgacgatactcagctttgttgtgctcggcgatgtagac
actcagaaaactgaagaatcccaggaaacagataaaacttgtgcactctcaacatctgga
agcaaaagttataaagaagatattgcagagatgtcacagtctttagaccaagaagttggg
cagaggaagattccacctcctggagatgggaagaaaatatatgacattgatcctatgttg
aacagtcatcgtactcatcttgattaccgatatgggcagtacagaaaactgcgtgaagaa
atcgacaagtatgaaggtggtttggaggcattttctcgtggttatgaaatatttggcttc
actcgaagcgccactggtatcacttaccgggaatgggcaccaggagctaaggcagcatca
ctgatcggagattttaataactggaatgcgaaagctgatgtaatggcccggaacgacttt
ggtgtgtgggaaatatttctgccaaataatgctgatggctcgtcagcaattccccatggc
tcccgtgtgaagattcgcatggataccccatctggtattaaagactccattccagcttgg
atcaagtattctgtccagccaccaggcgagatcccatacaatggagtatattatgaccct
gctgtggaggataaatatgtgttcaaacatcctcgtccaaggagacccacatcactgcgt
atatatgaatcacatgttggaatgagtagtacggaaccaaagataaatacatatgccaac
tttagagatgatgtacttccacgtataaaaaagctaggctataatgctgttcagataatg
gccattcaagaacatgcctactatgccagctttgggtatcatgtgacaaattttttcgca
cctagcagccgctttggaactcctgatgaccttaaatctttgatagacaaagctcatgag
ctaggtctggttgttctgatggatattgtgcacagccatgcatccaaaaacacactggat
ggcctggacatgtttgatggcactgatggtcaatatttccactctggatcgcggggttat
cattggatgtgggattctcgtcttttcaattacggaagctgggaagttcttaggtatctt
ctttccaacgcgagatggtggctggaagaatacaagtttgatgggttcagatttgatggt
gtgacttccatgatgtacactcatcatggactgcaggtcgaatttactgggaattacaat
gagtactttggatattctactgatgttgacgctgtggtctatctaatgctggtgaacgat
ttgattcatgggctataccctgaggctattgttgtcggcgaagatgttagcgggatgcca
gctttttgcattcctgtcgaagacggtggtgtgggttttgactaccgtctacacatggca
gttgcagataaatggattgagcttctcaagaagagagacgaggactggcaggttggtgat
ataactttcacacttaccaacaggaggtggggagaaaaatgtgtcgtctacgcggagagt
catgatcaagcccttgttggagacaaaacgatagctttctggctaatggacaaggacatg
tatgatttcatggctgttgatagacaggccactccacgggtagaccgtgggattgcttta
cacaaaatgatccgtctcattacgatgggattgggtggagaaggatacctcaatttcatg
ggaaacgaatttggacacccagaatggatcgacttcccaaggactgaccagcaccttcct
gatggcagagtcatccctgggaataatggtagttatgataaatgccgacgtaggtttgat
ttgggagatgcagaatatcttagataccatggactacaagagtttgatcgagcaatgcaa
aatctagaggagacgtatggtttcatgacttcagagcaccagtacatatcccgcaaggat
gaaggagacaaagtcattgtattcgagagaggtaacttgctcttcgtcttcaacttccac
tggaccaacagttactcagattaccgtatcggttgctctgttcccggaaagtacaaaatt
gttttggactctgataactctttattcggaggcttcaaccggctagatgactccgcagag
tttttcacctctgatggaagacacgatgataggccttgctccttcatggtttatgcgccg
tgcagaaccgctgtagtgtacgctgcagtagatgatgatgatgaccgttcttctcttgtc
cccataagcctgttacctgaagatgtttag

DBGET integrated database retrieval system