KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_322142Help
Entry
ARALYDRAFT_322142 CDS       T01578                                 

Definition
defective IN anther DEHISCENCE1
Orthology
K16818  
phospholipase A1 [EC:3.1.1.32]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Glycerophospholipid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ARALYDRAFT_322142
   00592 alpha-Linolenic acid metabolism
    ARALYDRAFT_322142
Enzymes [BR:aly01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.32  phospholipase A1
     ARALYDRAFT_322142
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 448 aa AA seqDB search
MRLSLSPVRPHSVLVPSLPKHDVVSYINGTTSNRQCRCVLTLPSPSVSTSRPPVLPKPET
WESLLLNQDHSSGEFSPSGSNNPVKLGRRWMEYQGLQNWDGLLDPLDENLRREILRYGQF
VESAYQAFDFDPSSPTYATCRFPRSTLLDRSGLPNSGYRLTKNLRATSGINLPRWIEKAP
SWMATQSSWIGYVAVCQDKEEISRLGRRDVVISFRGTATCLEWLENLRATLTHLPNGPTG
PNLNGSNSGPMVESGFLSLYTSGVHSLRDMVREEISRLLQSYGDEPLSVTITGHSLGAAI
ATLAAYDIKTTFKRAPMVTVISFGGPRVGNRCFRKLLEKQGTKVLRIVNSDDVITKVPGV
VLENREQENVKMSTTSIMPSWIQRRVEETPWVYAEVGKELRLSSRDSPHLNSINVATCHE
LKTYLHLVDGFVSSTCPFRETARRVLHR
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgagactctctctttctcccgtacgtccgcatagtgtactagtaccttcactcccaaag
cacgacgtcgtttcttatataaatggtacgacgtcgaatcgtcaatgtcgatgtgtactt
actcttccttctccttcagtttctacctcccgaccaccggttctacccaaaccggaaacc
tgggagagtttgctactaaaccaagatcatagttccggcgaattctcgccctctggttcg
aataacccggttaagcttggccggagatggatggagtaccaggggcttcaaaattgggat
ggtcttttagacccattggacgaaaatctccggcgtgagattctccggtacggtcaattc
gtcgaatcggcttatcaagcgtttgatttcgatccttcttctccaacctacgcgacatgc
cggtttccgaggagcactttgttagaccgatccggtttacctaattccggttatcgacta
acgaagaaccttcgtgccacgtcaggtattaacttgccacgttggattgagaaagcgcca
agctggatggctacacaatccagctggattggttacgtggcagtttgccaagacaaggaa
gagatctcacggcttgggcgtagagacgtcgtcatctccttccgtggaaccgccacgtgt
ctcgaatggttagagaaccttcgcgccacgctgactcatctccctaatgggcctactgga
ccaaatctaaacgggtctaactctgggcccatggtcgagagcgggtttttaagcttgtac
acttcaggggttcacagtttgagagacatggtcagagaagagatctcaaggctactccaa
tcttacggcgacgagccgctaagtgtaacgataacaggccacagcctcggagctgcgatc
gcgacactagccgcgtatgatatcaaaacgacgtttaaacgtgcgccgatggttaccgta
atatcttttggaggtccacgtgtcggaaacagatgctttcggaaactccttgagaagcaa
ggcacgaaggttctaagaatcgtgaactccgacgacgttatcaccaaagttcctggagtc
gttttagaaaacagagagcaagagaacgtgaagatgtcgacgacttcgataatgccgagc
tggatacagagacgcgtggaggagacgccgtgggtttacgccgaggtcggtaaggagctt
aggctgagcagccgtgactcgccgcacttgaacagcatcaatgtggctacgtgtcacgag
ctgaaaacgtatttacatttggtagacgggtttgtgagctccacgtgtccattcagagag
acggctcggagagttctccatagatga

DBGET integrated database retrieval system