KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_325356Help
Entry
ARALYDRAFT_325356 CDS       T01578                                 

Definition
(RefSeq) ATPPME1
  KO
K01051  pectinesterase [EC:3.1.1.11]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00040  Pentose and glucuronate interconversions
aly01100  Metabolic pathways
Module
aly_M00081  Pectin degradation
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ARALYDRAFT_325356
Enzymes [BR:aly01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     ARALYDRAFT_325356
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pectinesterase Pectate_lyase_3 DUF1565
Motif
Other DBs
NCBI-GeneID: 9307339
NCBI-ProteinID: XP_002871269
UniProt: D7M0I6
Position
Unknown
AA seq 361 aa AA seqDB search
MGYTNVSILLGLLVVFVSPVVFADDVTPIPEAKPQVAQWFKANVAPLAQRKGLDPALVAA
EAAPRIINVNPKGGEFKTLTDAIKSVPAGNTKRVIIKMAPGEYREKVTIDRNKPFITLMG
QPGAMPVITYDGTAAKYGTVDSASLIILSDYFMAVNIVVKNTAPAPDGKTKGAQALSMRI
SGNFAAFYNCKFYGFQDTICDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVVGDGI
RVIAAHAGKSAEEKSGYSFVHCKVTGTGGGIYLGRAWMSHPKVVYAYTEMTSVVNPTGWQ
ENKTPAHDKTVFYGEYKCSGPGSHKAKRVPFTQDIDDKEANRFLSLGYIQGSKWLLPPPA
L
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgggatacacaaatgtgtccattttattaggcctgttggtggtctttgtttcaccggtg
gtgttcgcagatgatgtgacaccaatcccagaggccaaaccccaagtggcgcagtggttc
aaggccaacgtcgctccattggctcaacgtaaaggcttagatccagctctcgttgctgct
gaggctgctccacgtatcatcaacgtgaatccaaagggaggtgaattcaaaacactaacg
gacgcaataaagagcgttcctgcagggaacacaaagcgggtgatcataaagatggctcct
ggggagtacagagagaaggtcactatcgacaggaacaaacccttcattacattgatggga
caacccggtgccatgcctgttatcacctacgacggtaccgccgccaagtatggaacagtt
gatagcgcctctctcattatcttatccgactatttcatggccgttaacatcgttgttaag
aatactgcaccggcgccagatggtaaaacaaagggagcacaagccttatctatgagaatc
tccggaaactttgctgctttctacaactgcaaattctacggtttccaagacacaatctgt
gacgataccggaaaccatttcttcaaggattgttacgtcgaaggaacattcgatttcatc
ttcggaagtggaacctctatgtacttgggaacacaattgcacgtggttggagatggtatt
agagtgatcgcagcgcatgcaggaaagagcgcagaagagaagagcgggtactctttcgtg
cactgcaaggtgactggaaccggtggtggaatctatttgggaagagcatggatgagtcac
cctaaggttgtctatgcctacaccgagatgaccagcgttgtcaaccccaccggatggcaa
gaaaacaagactcccgcacatgacaagaccgtgttctacggagagtacaagtgttcagga
ccaggatcacacaaagccaagagagtgccattcacacaagacattgacgacaaagaagct
aaccgtttcctttccctcggctacatccaaggatccaagtggcttctcccaccaccagct
ttgtaa

DBGET integrated database retrieval system