KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_327181Help
Entry
ARALYDRAFT_327181 CDS       T01578                                 

Definition
AT4g10060/T5L19_190
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    ARALYDRAFT_327181
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    ARALYDRAFT_327181
Enzymes [BR:aly01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     ARALYDRAFT_327181
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 921 aa AA seqDB search
MQKNDHMESELQTQMVGNERLPQVTWQRKLNSKVKNPSEFKMSIRDVLHLFPIGYRLWSH
TKEEAKKGRASMYDIFKKRHVTGDHGVPLGGIGGGSIGRSYKGEFQQFKLFPKVCEEAPI
LTNQFSVFVMRSGGVNYSSVLCPTKPKSVRGKTEELGIESWDWNMKGYKSMYHALYPRSW
TIYNEPDPELRIVSRQISPFIPHNYKESSLPVSVFTFTVTNLGKEEATVTLLFTWENSVG
GASGLTGEHFNSTMMERDGVHAIALHHKTSNGHPPVTYAIAAQETEDVHVSECSCFLVSG
HSPKDITAKEMWDEIKKNKSFDGLNSEPGSPSRPGTSIGAAIAANVKVPPGCDRTVMFSL
SWDCPEVRFNEKTYHRRYTKFYGNLGDAAVKMARDALLNYVDWESQIEAWQSPILSDTAL
PDWYRVTLFNELYYFNSGGTIWTDGLPPKERIERSKIINTEQNNIVTELFKKINVICAQI
HSPQSLNAEEHIGQFIYLEGIEYLMYNTYDVHFYSSFALLSLFPKLELSIQRDFAATVLF
QDPTKKQIMSSGEWVPRKLLGSVPHDIGLNDPWLELNEYNFFNTDRWKDLNAKFVLQVYR
DVVSTGDQSFAKAVWPSVYTAVAYLDQFDKDEDEMIENEGFPDQTYDAWSVKGVSAYCGG
LWVAALQAASAFASIVGENGVAIYFNTKYEKAKSVYEKLWNGSYFNYDDSGSGSSSSILA
DQLAGQWYARACGLKPITKEEWIKKALETIYEFNVMKVKGGTRGAVNGMSPDGQVDTNSL
VSKEVWAGTTYSVAACMIQEGQRERGFQTASGIYEAVWSDRGLSCSFQTPEAWNMNDEYR
SLCYMRPLAIWSIQWALTRTQSFGEEKEKLVKGEEEESDLLLRQHKGFKDVARFVKIVPT
RNEHRSRLQHTYEAVLNILRL
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagaatgatcacatggaaagtgaactccaaactcaaatggttggaaatgagaga
cttccacaagtaacgtggcaacggaagttgaacagcaaagtgaagaacccttctgagttc
aagatgagtataagagatgttcttcatctgtttccaataggctatagattgtggagtcac
actaaagaagaagcaaaaaaaggaagagcttcgatgtacgatatcttcaaaaagcgtcat
gtaactggcgaccatggcgtcccattaggtggaattggcggaggaagcatcggaaggagt
tacaaaggtgaatttcagcagtttaagctcttccctaaagtttgtgaagaagctccaatc
ctcacaaaccagttctctgtttttgttatgagatccggtggtgtgaattactcaagtgtt
ctatgcccaacaaagccaaaatctgtaagaggtaaaacagaggaattaggaatagaatca
tgggactggaacatgaaagggtacaaatctatgtatcatgctctgtatccgaggtcttgg
accatatacaacgagcctgaccctgaactcagaatagtttctcgccaaatttcgcctttt
ataccacataattacaaggaaagcagtcttccggtatcggttttcactttcacggtgact
aatcttggaaaagaagaagcaacggttactttgctctttacttgggagaactcagtggga
ggagcttcagggttaactggagaacacttcaactcaacaatgatggaaagagatggagta
catgcaatagctttacatcacaagacgtccaatggacacccgccagttacttacgccatt
gcagcgcaagaaacagaggatgttcatgtctctgagtgttcatgcttcttagtttctggt
cattctcctaaagatatcacagcaaaagagatgtgggatgagattaaaaagaacaaatca
tttgacgggttaaacagcgagccaggctcaccttcgagacccggaacatccattggagca
gccattgctgccaatgtgaaggttcctccaggttgtgaccgtactgtcatgttttcactc
tcatgggattgtcctgaggtgcggttcaatgaaaagacttaccacagaagatacacaaaa
ttctatggcaacttaggcgacgcagcagtgaaaatggctcgagatgctcttctgaattat
gttgattgggagtctcaaattgaagcatggcaaagccctattctttcagacactgcactt
cctgactggtaccgagttactctattcaatgaattatactatttcaactccggaggaact
atctggacagatggcttgcctcccaaggaacgcatagaaagaagcaagattataaataca
gaacagaacaacattgttactgaactcttcaagaaaatcaatgtgatttgtgctcagatt
cattctcctcagtccttgaacgcggaagagcacatcgggcaattcatctacctcgaagga
attgagtatctaatgtacaacacttacgacgttcacttctattcttcatttgcacttctc
agtctcttccctaagctcgaactcagcatccaaagagactttgcagcaacagttctgttt
caagatcccaccaagaaacagatcatgagttccggtgagtgggttcctagaaaacttctt
ggttctgttcctcatgatataggtctaaacgatccgtggcttgaactaaacgaatataac
ttctttaacacggatcgttggaaagacttgaacgccaagtttgttcttcaagtctacaga
gacgtggtttcaactggcgatcagagctttgcgaaagcggtttggccgtctgtttacaca
gcagttgcttacttagatcagttcgataaggacgaggacgagatgatcgaaaacgaaggg
tttccggatcaaacatacgatgcttggagtgttaaaggagttagtgcttattgtggcggt
ctctgggtcgctgctcttcaagctgcgtctgcatttgctagtattgttggggaaaacggt
gttgccatttacttcaatacaaagtatgaaaaggcgaaaagcgtttacgagaagctatgg
aatggttcttacttcaattatgatgatagcggtagcggctcgagctcctcgattcttgct
gatcagttggctggacaatggtatgcgagggcttgtggattgaagccgataacgaaagaa
gaatggataaagaaagcactcgagacgatctatgagtttaatgtaatgaaagtgaaagga
gggacacgaggggcagtgaacggaatgtcaccggacggacaagtggacacgaactcattg
gtttcaaaggaggtttgggctgggactacttactctgttgcagcttgtatgattcaagaa
gggcaaagagaaagagggtttcagacagcaagtggaatctacgaggctgtttggtctgat
cgtggtctcagttgctcatttcagacaccagaagcgtggaatatgaatgatgaatacagg
tctctgtgttatatgagacctcttgctatatggtctatacaatgggcattgacacgaaca
caatcttttggagaagagaaggaaaagttagtgaaaggcgaagaagaagaaagtgatttg
ttgttaagacaacacaaagggttcaaagatgtggctcgttttgtgaaaatagtaccaacg
agaaatgaacatagaagccgtctccaacacacgtacgaggccgtcctaaatattctccgc
ttatag

DBGET integrated database retrieval system