KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_328774Help
Entry
ARALYDRAFT_328774 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 134 aa AA seqDB search
MSWQTYVDEHLMCDVGDGQGHHLTAAAIVGHDGSVWAQSSNFPQFKGQEFSDIMKDFDEP
GHLAPTGLFLAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQSCVFGIYEEPVTPGQCNM
VVERLGDYLLEQGL
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggcaaacttacgttgatgagcatttgatgtgtgatgttggcgatggtcaagga
caccaccttaccgctgctgctatcgttggtcatgatggtagcgtttgggctcagagctcc
aactttcctcagttcaagggacaggagttcagtgatataatgaaagatttcgatgaaccg
ggtcacttggcaccaacagggttattcctagcaggagctaagtacatggttatccaaggc
gagcccggggctgtaatccgtggcaagaagggagcaggaggcataacgataaagaaaaca
ggccagtcatgtgtgtttgggatctatgaagagccagtgacaccaggacagtgcaacatg
gtcgtcgaaaggttgggtgattacctcctcgaacagggtctctag

DBGET integrated database retrieval system