KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_330245Help
Entry
ARALYDRAFT_330245 CDS       T01578                                 

Definition
AMP binding protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ARALYDRAFT_330245
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ARALYDRAFT_330245
   00620 Pyruvate metabolism
    ARALYDRAFT_330245
   00640 Propanoate metabolism
    ARALYDRAFT_330245
Enzymes [BR:aly01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ARALYDRAFT_330245
Lipid biosynthesis proteins [BR:aly01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ARALYDRAFT_330245
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 743 aa AA seqDB search
MKIASPSSPILTVVSSSGSLDPKISGSLGSRILPATQRSSPSDNLLLHRTMSSNYLRHVE
SMSQLPSGTGKISQLNAVVLGESLASEENDLIFPSKEFSGQALVSSPQQYMEMHKRSMDD
PAGFWSDIASEFYWKQKWGDQVFSENLDVRKGPISIEWFKGGITNICYNCLDKNVEAGLG
DKTAIYWEGNELGVDASLTYSELLQQVCQLANYLKDNGVKKGDAVVIYLPMLMELPIAML
ACARIGAVHSVVFAGFSADSLAQRIIDCKPKVILTCNAVKRGPKTINLKAIVDAALDQSS
KDGVSVGICLTYDNSLATTRENTKWQNGRDVWWQDVISQYPTSCEVEWVDAEDPLFLLYT
SGSTGKPKGVLHTTGGYMIYTATTFKYAFDYKSTDVYWCTADCGWITGHSYVTYGPMLNG
ATVVVFEGAPNYPDSGRCWDIVDKYKVSIFYTAPTLVRSLMRDDDKYVTRHSRKSLRVLG
SVGEPINPSAWRWFFNVVGDSRCPISDTWWQTETGGFMITPLPGAWPQKPGSATFPFFGV
QPVIVDEKGIEIEGECSGYLCVKGSWPGAFRTLFGDHERYETTYFKPFAGYYFSGDGCRR
DKDGYYWLTGRVDDVINVSGHRIGTAEVESALVLHPQCAEAAVVGIEHEVKGQGIYAFVT
LLEGVPYSEELRKSLVLMVRNQIGAFAAPDRIHWAPGLPKTRSGKIMRRILRKIASRQLE
ELGDISTLADPSVVDQLIALADV
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagcttctccttcttctccgattctcaccgttgtctccagctcaggctcattg
gatccgaaaattagtggatcacttggatctcgaatccttccggctactcaaagatcatcc
ccatcggacaatcttctcctccataggacaatgtcatctaattacctgaggcatgtggag
tccatgtcccagctaccctcaggtaccggaaagatctctcaattaaacgccgttgtttta
ggagaatcccttgcatcggaggagaatgatctcatctttcccagcaaggaattctccggc
caggctcttgtttcctcccctcaacagtacatggaaatgcataagaggtcgatggatgac
cctgctggtttttggtctgatattgcgtctgagttttactggaagcagaaatggggtgac
caagtgttttccgaaaatctcgatgtcaggaagggtcctattagcattgagtggtttaaa
gggggaatcaccaatatttgctacaactgtttggacaaaaacgttgaagctgggttgggt
gataaaacagccatatactgggaaggaaatgaacttggggtagatgcttccttaacttat
tctgagttgctccaacaagtttgccagcttgctaattacttaaaagataatggcgtgaag
aagggggatgccgttgtaatttatttacctatgttgatggaacttcccatcgctatgctt
gcatgtgcacggatcggagctgttcattcggtcgtttttgcgggattttctgctgactct
cttgcccaaagaatcattgattgcaagccaaaagtgatactgacttgcaatgctgttaaa
agaggccctaagaccataaaccttaaagctattgttgatgctgcacttgaccaatcttct
aaagatggagtctctgtaggcatatgcttgacctatgacaactcattagcgacaacaagg
gaaaacacaaaatggcagaatggaagagatgtgtggtggcaggatgtcatttctcaatat
ccaacatcgtgtgaggtggaatgggttgatgcggaagatcccctgtttttgctctacaca
agtggaagtaccgggaagccaaagggtgtcctacacacaactggagggtatatgatctac
actgctacaacattcaagtatgcatttgattacaaatcaacagatgtatactggtgtaca
gcagactgtggttggataactggccatagctatgttacttatggaccaatgctaaatgga
gccactgttgttgtctttgaaggggctccaaactaccctgattctggacgctgttgggat
attgttgacaaatacaaagtttccatattttatactgccccaacattggtgaggtctctc
atgcgtgatgacgataagtatgtaacacgtcactctcgcaaatcgctacgggtccttgga
agtgtgggagagcccatcaatcctagtgcctggagatggttcttcaatgtagtcggtgac
tcaaggtgtcccatttcagatacgtggtggcaaactgaaactggtggcttcatgataacc
ccattgccaggtgcttggccacagaagcctggttcagctactttccctttctttggtgtt
cagcctgtcatagttgatgaaaaaggcattgaaatcgaaggcgagtgtagtggttatctt
tgtgtcaaaggttcatggcctggggcgtttcgaactctgtttggggatcatgaaagatat
gaaaccacatactttaaaccttttgccggatattatttcagtggtgatggttgcagaaga
gacaaggatggttactactggcttacagggagggttgatgatgttatcaacgtcagtggc
catcgaatcggaactgctgaagtggaatctgctctggttttacatcctcaatgtgcagaa
gcagctgttgtaggcatagaacatgaggtaaaaggtcagggaatttatgcgtttgtcact
cttctggaaggtgttccttacagcgaggagcttcggaaaagcctagtactaatggtccga
aatcagattggggcttttgcagcaccggacagaatacattgggcaccagggttgccaaag
acgagaagcggaaagataatgaggagaatcttgagaaagattgcttcaaggcaattagaa
gaactcggagatattagcacactcgcggatcctagtgtagttgatcagcttattgcactt
gccgatgtgtga

DBGET integrated database retrieval system