KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_330245Help
Entry
ARALYDRAFT_330245 CDS       T01578                                 

Definition
(RefSeq) AMP binding protein
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00010  Glycolysis / Gluconeogenesis
aly00620  Pyruvate metabolism
aly00640  Propanoate metabolism
aly01100  Metabolic pathways
aly01110  Biosynthesis of secondary metabolites
aly01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ARALYDRAFT_330245
   00620 Pyruvate metabolism
    ARALYDRAFT_330245
   00640 Propanoate metabolism
    ARALYDRAFT_330245
Enzymes [BR:aly01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ARALYDRAFT_330245
Lipid biosynthesis proteins [BR:aly01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ARALYDRAFT_330245
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 9304552
NCBI-ProteinID: XP_002870488
UniProt: D7MI40
Position
Unknown
AA seq 743 aa AA seqDB search
MKIASPSSPILTVVSSSGSLDPKISGSLGSRILPATQRSSPSDNLLLHRTMSSNYLRHVE
SMSQLPSGTGKISQLNAVVLGESLASEENDLIFPSKEFSGQALVSSPQQYMEMHKRSMDD
PAGFWSDIASEFYWKQKWGDQVFSENLDVRKGPISIEWFKGGITNICYNCLDKNVEAGLG
DKTAIYWEGNELGVDASLTYSELLQQVCQLANYLKDNGVKKGDAVVIYLPMLMELPIAML
ACARIGAVHSVVFAGFSADSLAQRIIDCKPKVILTCNAVKRGPKTINLKAIVDAALDQSS
KDGVSVGICLTYDNSLATTRENTKWQNGRDVWWQDVISQYPTSCEVEWVDAEDPLFLLYT
SGSTGKPKGVLHTTGGYMIYTATTFKYAFDYKSTDVYWCTADCGWITGHSYVTYGPMLNG
ATVVVFEGAPNYPDSGRCWDIVDKYKVSIFYTAPTLVRSLMRDDDKYVTRHSRKSLRVLG
SVGEPINPSAWRWFFNVVGDSRCPISDTWWQTETGGFMITPLPGAWPQKPGSATFPFFGV
QPVIVDEKGIEIEGECSGYLCVKGSWPGAFRTLFGDHERYETTYFKPFAGYYFSGDGCRR
DKDGYYWLTGRVDDVINVSGHRIGTAEVESALVLHPQCAEAAVVGIEHEVKGQGIYAFVT
LLEGVPYSEELRKSLVLMVRNQIGAFAAPDRIHWAPGLPKTRSGKIMRRILRKIASRQLE
ELGDISTLADPSVVDQLIALADV
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagcttctccttcttctccgattctcaccgttgtctccagctcaggctcattg
gatccgaaaattagtggatcacttggatctcgaatccttccggctactcaaagatcatcc
ccatcggacaatcttctcctccataggacaatgtcatctaattacctgaggcatgtggag
tccatgtcccagctaccctcaggtaccggaaagatctctcaattaaacgccgttgtttta
ggagaatcccttgcatcggaggagaatgatctcatctttcccagcaaggaattctccggc
caggctcttgtttcctcccctcaacagtacatggaaatgcataagaggtcgatggatgac
cctgctggtttttggtctgatattgcgtctgagttttactggaagcagaaatggggtgac
caagtgttttccgaaaatctcgatgtcaggaagggtcctattagcattgagtggtttaaa
gggggaatcaccaatatttgctacaactgtttggacaaaaacgttgaagctgggttgggt
gataaaacagccatatactgggaaggaaatgaacttggggtagatgcttccttaacttat
tctgagttgctccaacaagtttgccagcttgctaattacttaaaagataatggcgtgaag
aagggggatgccgttgtaatttatttacctatgttgatggaacttcccatcgctatgctt
gcatgtgcacggatcggagctgttcattcggtcgtttttgcgggattttctgctgactct
cttgcccaaagaatcattgattgcaagccaaaagtgatactgacttgcaatgctgttaaa
agaggccctaagaccataaaccttaaagctattgttgatgctgcacttgaccaatcttct
aaagatggagtctctgtaggcatatgcttgacctatgacaactcattagcgacaacaagg
gaaaacacaaaatggcagaatggaagagatgtgtggtggcaggatgtcatttctcaatat
ccaacatcgtgtgaggtggaatgggttgatgcggaagatcccctgtttttgctctacaca
agtggaagtaccgggaagccaaagggtgtcctacacacaactggagggtatatgatctac
actgctacaacattcaagtatgcatttgattacaaatcaacagatgtatactggtgtaca
gcagactgtggttggataactggccatagctatgttacttatggaccaatgctaaatgga
gccactgttgttgtctttgaaggggctccaaactaccctgattctggacgctgttgggat
attgttgacaaatacaaagtttccatattttatactgccccaacattggtgaggtctctc
atgcgtgatgacgataagtatgtaacacgtcactctcgcaaatcgctacgggtccttgga
agtgtgggagagcccatcaatcctagtgcctggagatggttcttcaatgtagtcggtgac
tcaaggtgtcccatttcagatacgtggtggcaaactgaaactggtggcttcatgataacc
ccattgccaggtgcttggccacagaagcctggttcagctactttccctttctttggtgtt
cagcctgtcatagttgatgaaaaaggcattgaaatcgaaggcgagtgtagtggttatctt
tgtgtcaaaggttcatggcctggggcgtttcgaactctgtttggggatcatgaaagatat
gaaaccacatactttaaaccttttgccggatattatttcagtggtgatggttgcagaaga
gacaaggatggttactactggcttacagggagggttgatgatgttatcaacgtcagtggc
catcgaatcggaactgctgaagtggaatctgctctggttttacatcctcaatgtgcagaa
gcagctgttgtaggcatagaacatgaggtaaaaggtcagggaatttatgcgtttgtcact
cttctggaaggtgttccttacagcgaggagcttcggaaaagcctagtactaatggtccga
aatcagattggggcttttgcagcaccggacagaatacattgggcaccagggttgccaaag
acgagaagcggaaagataatgaggagaatcttgagaaagattgcttcaaggcaattagaa
gaactcggagatattagcacactcgcggatcctagtgtagttgatcagcttattgcactt
gccgatgtgtga

DBGET integrated database retrieval system