KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_330267Help
Entry
ARALYDRAFT_330267 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K15406  
wax-ester synthase / diacylglycerol O-acyltransferase [EC:2.3.1.75 2.3.1.20]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Cutin, suberine and wax biosynthesis
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Lipid metabolism
   00073 Cutin, suberine and wax biosynthesis
    ARALYDRAFT_330267
Enzymes [BR:aly01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.20  diacylglycerol O-acyltransferase
     ARALYDRAFT_330267
    2.3.1.75  long-chain-alcohol O-fatty-acyltransferase
     ARALYDRAFT_330267
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 500 aa AA seqDB search
MLYNSSIHYKGWRILKPTMKTENVMEREEIETTPMEPLSPMSHMLSSPNFFIVITFGFKV
RCNPSAFVEGINNSLINAPRFSSKMEIDYKRKGDPVWIPVKVRVEDHVIVPDPEYSNIEN
PDHFIEDYTSNIANIPMDMSKPLWEFHLLNIKTSKAESLAIVKIHHSIGDGMSLMSLLLA
CSRKTSDPDALISTTTATKKPVDSMAWWLFVGFWFMIRVTFTTIVEFSKLMLTICFLRDT
KNPLMGNPSDGFQSWKVVHRIISFEDVKLVKDTMNMKVNDVLLGMTQAGLSRYLSSKYDG
STAEKKKIVEKLRVRGAVAINLRPATKIEDLADMMAKGSKCRWGNFIGTIIFPLWVKPEK
DPLEYIRRAKATMDRKKISLEAFIFYGIIKFTLKFFGGKAVEAFGKRIFGHTSLAFSNVK
GPDEEISFFHHPISYIAGSALVGSQALNIHFISYVDKIVINLAVDTTTIADPHRLCDDMV
EALEIIKSATQEKRFHKTEV
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgctatataattcaagtatccactacaaaggttggagaatccttaaaccaactatgaaa
acggaaaatgttatggagagagaagagatcgagacaacgccaatggagccacttagccca
atgtcacatatgctaagttcgccaaatttcttcattgtgataacttttgggtttaaagtt
agatgcaacccatcggcctttgttgaaggcatcaacaactcattgatcaatgctcccaga
ttctctagcaaaatggagatagattataagagaaaaggagacccggtctggattcctgtt
aaagttcgagtagaagatcatgttattgtgccagatcctgaatattccaacattgaaaat
cctgatcatttcatagaagactatacatcaaacattgctaatattccaatggacatgtcc
aaacctctttgggaatttcatttactcaacataaagacatcaaaagcagaatctttggct
atagtaaaaatacatcactcaattggtgatggaatgtctcttatgtcacttttacttgct
tgttcacgaaaaacatcagaccctgacgcgctaatttctactaccacggctacaaagaaa
cccgttgattccatggcttggtggttgtttgttgggttttggtttatgataagagtcacc
ttcaccactattgttgaattttccaagttaatgcttacaatatgctttttgcgagatacc
aaaaaccctcttatgggtaatccgagtgatggatttcaatcttggaaggttgtccatcgg
ataataagttttgaggatgtcaagttagtgaaggacacaatgaacatgaaggtgaatgat
gttcttcttggaatgacacaagcaggtctttcaagatatttgagtagcaaatatgatgga
tcaacggccgagaagaaaaagatcgtagaaaaactccgtgttcgtggtgctgtagctata
aacttaagaccagcaacaaagatagaggatttggctgatatgatggcgaagggttcaaag
tgtagatggggaaacttcattggaacaattatatttcctttgtgggtgaaaccagagaag
gatccattggagtacattcgacgagccaaagctacgatggataggaagaaaatatctctg
gaagcttttattttctatggcatcattaaattcaccttgaaattttttggaggaaaggca
gtagaagcttttggaaagaggatatttggtcacacatcattggcattttcaaatgtgaaa
ggtcccgatgaagaaataagtttttttcaccatccgatttcatatatcgcaggaagtgca
ttagttggatcacaagctctcaatatccattttataagctacgtagacaagattgtcatc
aatctagctgttgatacaacaacgattgcagatcctcatcgactatgcgatgatatggta
gaagcactcgagataatcaaatctgccacacaggagaaaagatttcataaaacggaagtt
tga

DBGET integrated database retrieval system