KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_331392Help
Entry
ARALYDRAFT_331392 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:aly00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:aly00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 956 aa AA seqDB search
MFEEKIITIGEDVKSFNSSDHKVDPAVPASLTWQRKIDSDAKPPREFNLTAKEIFQLAPV
GIRLWFLCREEAAKGRLAFIDPFSRHSVTSSHGVPLGGIGAGSIGRSFQGEFQRWQLFPP
KCEYEPVLANQFSAFVSRANGKKYSTVLCPRNPKMGKQDSESGIGSWDWNLKGDKSTYHA
LYPRSWTMYEGEPDPELRIICRQVSPFIPHNYKESSFPVSVFTFTLHNLGNTTANVTLLF
TWANSVGGDSEFSGGHYNSKIMMNDGVQGVLLHHKTANGLPSLSYAISAQATDGVSVSAC
PFFIVSGKQNGITAKDMWQAVKENGSFDHFKASEASMQSENGSSIGAAVAASLTVLPGES
RIVTFSLAWDCPEVQFPSGKIYSRRYTKFYGNHGDAAAQIAYDAILGHSQWESWIEDWQR
PILEDKRLPAWYPVTLFNELYYLNSGGTLWTDGSSPVHSLAGVREKKFSLDKSQLGLNND
IEVPHQNDTAISVLGKMASTLEQLHASTASNSAFGTKLLEEGEENIGHFLYLEGIEYRMW
NTYDVHFYASFALVMLFPKLELSIQRDFAAAVMLHDPTKVKTLSEGQWVQRKVLGAVPHD
LGINDPWFEVNGYTLHNTDRWKDLNPKFVLQVYRDVVATGDKKFASAVWPSVYVAMAYMA
QFDKDGDGMIENEGFPDQTYDTWSASGVSAYCGGLWVAALQAASVLARVVGDKNSQDYFW
SKFQKAKVVYEKKLWNGSYFNYDNSGSQYSSSIQADQLAGQWYARASGLLPIVDEDKART
ALEKVYNFNVMKIKDGKRGAVNGMHPNGKVDTASMQSREIWSGVTYALSATMIQEGLVEM
AFQTASGVYEAAWSEAGLGYSFQTPEAWNTNDEYRSLTYMRPLAIWAMQWALTKTSQKQQ
QLGLEPEQEPEVETNSLMKHDIGFSRVSRLLNLPNEASAKSTLQTLFDYTCRRLMS
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaggaaaagatcataactattggtgaagatgtaaaatctttcaactcttctgat
cataaagttgatccagcagtacctgcatctttgacatggcaaagaaagatagacagtgac
gcaaagcctccccgggaattcaatctgactgctaaagagatttttcagctggctcctgtt
ggcattcggttatggtttctttgcagagaagaagctgctaaaggaaggttggccttcata
gatccattctctaggcactctgtaacgtcttcccatggtgttccacttgggggtattggt
gctggtagcataggaaggagttttcaaggtgaattccagcgatggcagctattccctcca
aaatgtgaatatgaacctgttctagcaaatcaattctcagcgtttgtttcacgcgccaat
ggtaaaaagtactcgacggtgttatgtcctaggaatccaaagatgggaaaacaagattcg
gaatcaggaattggttcctgggactggaatctgaaaggagacaagtctacatatcatgct
ttatatccgaggtcttggacaatgtatgagggtgaacctgatccagagcttaggatcatt
tgtcggcaagtttcaccctttatacctcacaactacaaagagagcagctttcctgtgtct
gttttcactttcacacttcataatctcggaaacactactgcgaatgtgacattgctcttc
acttgggcgaattctgttggaggagactcagagttctcaggtggccactacaactccaaa
ataatgatgaatgatggagtccagggtgtgctcttacatcataaaaccgcaaatgggtta
ccatcattgtcatatgcgatttcagctcaggcgaccgatggtgttagtgtctcagcctgc
ccatttttcatagtgtctggaaagcagaacggaatcacagcaaaagatatgtggcaagct
gtcaaagagaatggttcttttgatcacttcaaagcttctgaggcgtcaatgcagtcagag
aacgggtcatcgattggggcagcagtagcagcttctttaacagtcctaccgggagagtca
cgcattgtcacattttctctggcttgggactgtcctgaagtgcagtttcctagtggtaaa
atatattctaggcgttacacaaagttttatggcaatcatggtgatgctgcagcacaaatt
gcatatgatgctattcttggacatagtcagtgggagtcctggatagaagattggcaaaga
ccaatacttgaagacaaaagacttcctgcatggtaccctgtcactctcttcaacgagctt
tattaccttaattcaggaggaactctttggacagatggatcatcaccagtacatagcttg
gcaggagtcagagaaaagaagttctcacttgataaatcccaactcggtctgaataatgat
atcgaggtaccacatcagaatgatacagctatctctgtccttggaaagatggcttctaca
cttgagcaacttcatgcatcaacagcatcaaactctgcatttggtacaaagttacttgaa
gaaggagaagagaacattggacacttcctttacttagaaggcattgaatatcgtatgtgg
aacacttatgatgttcatttctatgcatcttttgcactggtgatgctgtttccaaaactt
gaacttagtatccagagagactttgctgctgcggtgatgctacacgatcccactaaagtg
aagacgcttagcgagggacaatgggttcaaaggaaggttcttggtgcagttcctcatgac
ttaggcatcaatgacccttggtttgaagtcaatggatatactcttcacaatacagatcgt
tggaaagatttgaaccccaaattcgtcctccaagtgtaccgggatgtagttgccacaggc
gacaaaaagtttgcatcagcggtctggccctcagtgtatgttgcaatggcatatatggct
cagtttgacaaagatggcgatggaatgattgagaacgaaggatttccagatcagacttac
gatacatggtccgcgtctggtgtaagcgcttactgtggtggactttgggtggctgcactg
caagctgcatccgtattggcacgcgtagttggtgacaagaactcacaggactatttctgg
tcaaagtttcagaaagcaaaagttgtatatgagaagaagttgtggaatggatcttatttt
aactatgacaacagtggaagtcagtatagctcgtctatccaagctgatcaactagctggt
caatggtatgcgagagcatccggtcttttgcctattgtagatgaagacaaggcaagaact
gctttggagaaagtttataactttaatgtgatgaagattaaagatgggaaacgtggggct
gtaaatgggatgcatcccaatgggaaagttgatacagcatcgatgcaatcacgagagata
tggtccggtgttacatatgcattgtctgcaacaatgattcaagaaggtctagttgaaatg
gcatttcagactgcaagtggtgtctatgaagctgcctggtctgaagccggactcgggtac
tcctttcagacgcctgaagcgtggaatacgaatgatgagtatagatcactgacttacatg
cgtccccttgcaatatgggctatgcaatgggcactgacaaaaaccagtcaaaaacagcaa
caacttggtcttgaaccagaacaagaaccagaagtagagactaactctttaatgaaacat
gatatcgggttttctcgggtttctaggcttctgaatctacctaatgaagcatcagctaaa
agcacactgcagactttgttcgactatacttgcaggagactgatgtcatag

DBGET integrated database retrieval system