KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_337685Help
Entry
ARALYDRAFT_337685 CDS       T01578                                 

Definition
histone acetyltransferase HAC4
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Brite
Enzymes [BR:aly01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     ARALYDRAFT_337685
Transcription factors [BR:aly03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    ARALYDRAFT_337685
Mitochondrial biogenesis [BR:aly03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    ARALYDRAFT_337685
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1563 aa AA seqDB search
MNNNVPQNSVAVARRTALRNRIYAIVKHKQQQQHQIFLHKKNQQPTQDAILEKQDQKCIA
ATRMIEEKLLKSSRSFDEYSDLTTFDARVQTMLQQLGTILSQRRAAMNNGGAQCITPTRA
VHTSTSVSNNSFQSGRSLVPINCTTAAAGGLFSIGPDMHTHHSTGANHQMVEVNRPNMNQ
ITCGISSPLITGFNGNCVPVSANIPMTSQDLFNATLLNCVPPDQSHMHRYSMSNVASFGQ
SNPYPCGIVVSSSSMAVSQNSTPWNPNPMQGLDATVTSYHSNLQPMQQTPLPKRQLHHPL
WNTNFQSAPNNRENLPQVSQQLLNHGSHQHRGQHSQNLYPGQLQNQDHLLPNLTQQAMAL
AAPVMHVPSLESYEEALQKHATKNGFKPSKLQCQQTAVQDHYIGAQSVSVHSSQMNSSPS
LQPHPHQKQSESIPVQRQTSLQNSTEILQNNNGQREHTHMQPEPVHRVSSPIAPINSQTV
SPRNTVERKRPRDGNDTSSKQVNEDCGQTSSNTVLRWIPFMFHARHCKAKKDKCASKFCF
QARKIVKHIDCCKVPNCKYRYCLGTRMWLDHFKQCKSISCRTCVAVREYMEKNKYTIVPL
RRAKCSSASSKCQPKKSSKSRKAYKKGGAEAPSVDADLQRSIKRPKLQRPSQNITPETKS
ISVTGCGVVCKPHSLMNMQEKDGLQSLKVEAMPMDIDVPDASEIPVTRELVKHVAEDTPK
GNNCGGFVMDEKTSCLLAQGKSKCMNEMSAPKEENVKQSVEVVDASKMEISSLVELFTPE
QVKEHIRSLRQWVGQSKTKADKNKAMGCSMSVNSCQLCAVEWLVFEPVPLYCSPCGIRIK
KNALHYSIAAGESRHYVCAPCYNEARENLVFLDGTSIPKTRLEKKKNDEQVPEGWVQCDK
CEAWQHQICALFNSRRNHGETTKYTCPNCYIQEVEQRERRPLPLSAVPGATNLPVTALSN
HLEERLFKKLREERQERARLQGKTYEEVPGAESLTVRVVASVDKVLEVKQRFLELFREKN
YPTEFPYKSKAILLFQKIENVEVCLFGMFVQEFGTDSGPPNERRVYLSYLDSVKYFRPEV
RTVSGEALRTFVYHEILIGYLDYCKKRGFTSCYIWACPPLKGEDYILYCHPEIQKTPKTD
KLREWYLAMLRKASKEDVVVECTNLYNHFFVQSGECRANVTAARLPYFDGDYWPSAAEDL
LRQMNQEDDGETKLNRKGLTKKVISKRALKAVGQLDLSLNASKDRLMMQKLGETICPMKE
DFIMVHLQHCCKHCTTLMVSGNRWVCNHCKNFQICDKCNEVEQNRINIERHPINQKEKHA
LFPVAIKDVPVKIEDTDDNLESEFFDNRQAFLNLCQGNNYQYDTLRWAKHSSMMILYHLH
NPTAPAFATFCTICQQEVENSQGWHCEVCPGYDVCSACYSKASINHSHNLINRSSSTESP
VVQENRQASQNYQVQLEKLKEVLVHVAACRSTLCQYQGCRKFKTFFRHCIACKTGPGRCP
HCKRVWNLLRLHARSCRDSQCTVPKCRDFREISSRQQQQSDKRRRAAVMEMMRERAAEAT
RTG
NT seq 4692 nt NT seq  +upstreamnt  +downstreamnt
atgaataataatgttcctcagaactctgttgctgttgcgagacgcactgctttaagaaat
agaatttatgctatcgtaaaacacaagcagcagcagcagcatcaaatctttctacacaag
aagaatcagcagcccacgcaagatgctatcttagagaagcaggatcaaaagtgtattgcc
gcaacaagaatgattgaggaaaaactcctcaagtcttcccgatcatttgatgagtactcc
gatttaacaacttttgacgctcgtgtacaaactatgttgcaacagcttggaacaatcctt
tctcagcggcgtgctgccatgaataatggaggggctcaatgtattacacctacccgcgcg
gtccatacttccacgagcgttagtaacaactctttccaatccggaagaagccttgtgcca
attaattgcaccactgcagcagctggaggattattttctattgggcctgacatgcacaca
caccattctactggtgctaatcaccagatggttgaagttaataggccaaatatgaaccaa
attacttgtgggatctctagtcctctgattactggatttaacggcaactgtgtaccagtt
tctgctaatatacccatgacttctcaagacctcttcaatgctacacttctcaactgtgta
ccacctgatcagtcacacatgcatagatactcaatgagcaacgttgcttcttttggtcaa
agtaatccctatccctgtggaattgttgtgtcatctagctcaatggcagtttctcagaat
tcaactccatggaaccccaatcctatgcagggacttgacgctaccgtcacaagttatcac
tcaaacctgcaaccaatgcaacaaaccccattgccaaaacgtcaactacatcatccgctt
tggaatactaatttccaatctgctcccaataacagagaaaacttgcctcaggtcagtcaa
caactcttaaatcatgggtctcaccagcaccgaggacaacactcccaaaatctttatcct
ggccaactccagaaccaagatcatttacttcccaatctgactcagcaagctatggcttta
gctgctcctgtcatgcatgtaccaagcttggaatcctacgaagaagctcttcagaaacat
gctactaaaaatggattcaaaccatccaagttgcagtgccaacagactgctgttcaagac
cattacattggtgctcaaagtgtatctgtccacagtagtcagatgaattcttctccatct
ttgcaaccacatcctcatcaaaagcagtcggaatcaatcccggttcaaaggcagacatct
ctacagaactcaactgaaatattacaaaacaataatggacagagagaacatactcatatg
cagcctgaacctgtccatcgtgtctcatctccaatagcgcctataaacagtcaaactgtt
tctcctagaaatactgttgagaggaaacgtcctcgggatggaaacgatacatcaagtaaa
caggttaatgaagattgtggtcaaacgtcttcgaacaccgttctgcggtggattccgttt
atgttccatgcacgtcattgcaaggctaagaaagataagtgtgcgagcaagttttgcttt
caagccagaaagatagtgaaacatatagactgctgcaaggtccctaactgcaaatataga
tattgtcttggtactcggatgtggttagatcatttcaagcagtgcaaaagcatatcgtgc
cgtacctgtgtagctgtcagagaatacatggaaaagaataaatacacaattgtacctctc
cgtagagctaagtgtagctcagctagttcgaaatgtcaacccaagaaatcctcaaaatcc
aggaaagcatataaaaaaggaggtgctgaagctccatctgttgatgctgatctgcaacgc
tcaatcaagcgcccaaaattacagcgaccctcccaaaatatcactcccgagacgaagagc
atttcggtgacaggatgtggtgttgtttgtaaacctcattccttaatgaatatgcaagag
aaagatggtttgcaaagcctcaaagttgaggctatgcctatggacatagatgttcctgat
gcttctgagattcccgttaccagggagctggtgaaacatgttgctgaagatactcccaag
ggtaataattgtggtggttttgttatggatgaaaaaactagttgcttattggcacaaggg
aaatccaaatgtatgaatgaaatgagtgcaccaaaggaagagaatgtgaaacagtctgtg
gaagttgtagatgcgtctaagatggaaatctcctcacttgttgaattgtttactcctgag
caagtaaaggagcatatccgcagtcttcgtcagtgggtaggacagagtaaaaccaaggca
gacaaaaacaaagcaatggggtgctccatgtctgtgaattcttgtcagttatgtgctgtt
gagtggcttgtatttgagccagtacctctctactgctcaccttgtggtatacgcatcaag
aaaaatgccttgcactatagtattgcggctggtgagtcaaggcattatgtctgtgcacct
tgctacaatgaagcgcgtgaaaacttggtttttcttgatggaacttctataccgaaaaca
aggcttgagaaaaagaaaaatgatgaacaagttccggaagggtgggtgcaatgtgataag
tgtgaagcatggcagcatcaaatttgtgctttgttcaacagccgaagaaatcatggagaa
accaccaagtacacttgccctaattgctatatacaagaggtggaacaaagagaaagaaga
ccattaccactaagtgctgttccgggggcaacaaatttaccagttactgctcttagcaac
catctagaggagcggttattcaaaaagttgagggaggaaagacaagagagggctagactt
caaggaaaaacttatgaggaggtccctggagctgaatcacttactgtcagagttgtggca
tcggttgataaagtattagaagtaaagcaacgtttccttgagcttttccgagaaaaaaat
tatccaactgagttcccttataaatccaaggccattttgctgtttcagaagattgaaaat
gtggaagtatgcttatttggtatgttcgtccaggaatttgggacagactctggacctccc
aatgagcggcgggtatacctttcttatctggactctgttaagtatttcagacctgaggtt
cgaactgtgtctggagaagcccttcgcacctttgtgtaccatgaaattctgattggttat
ctcgattattgtaagaaacgtggttttacaagctgctatatatgggcatgtcctccactt
aagggtgaagattacattctttattgtcatcctgaaatccagaagactccaaagactgac
aaactaagggaatggtatttggcaatgttaagaaaagcttcaaaagaagatgtggtcgtt
gaatgcacaaacctctacaatcatttttttgtccagtctggtgaatgtagagctaatgta
actgctgcaaggttgccatattttgatggagactactggccaagtgctgctgaggattta
ctacgccaaatgaaccaagaagatgatggtgagacaaagttaaatagaaaaggattgacc
aaaaaggtcatatcgaaaagagccctaaaagccgttggccagttggacctttctcttaat
gcctccaaggatcgacttatgatgcaaaaactcggtgagaccatttgtccgatgaaggaa
gattttataatggttcatttgcaacattgctgcaagcattgtaccactctcatggtatct
ggaaaccggtgggtctgcaatcattgcaagaattttcagatctgtgacaagtgtaatgaa
gtggaacagaaccgcataaatatagagagacatccgattaatcagaaagagaaacacgcg
ctatttcccgtggccatcaaagacgttcccgtcaagattgaggacacagatgacaacctg
gagagcgaattctttgataacagacaagctttcttgaatctttgccaaggaaataactat
cagtacgacactctaaggtgggccaaacattcttccatgatgattctctatcatcttcac
aacccaactgcccctgcatttgctacattttgcaccatctgccaacaagaagttgaaaac
tctcaaggctggcactgtgaagtttgtccgggctatgatgtctgcagtgcctgttactcg
aaggcgtctatcaaccattcacataacctgataaaccgttcatcttctaccgagagtcct
gttgtacaagagaacaggcaagctagtcaaaattatcaagtccagctagagaagttaaaa
gaagtgctggtacatgtagctgcatgccgctctacactgtgccaatatcaaggttgtcgt
aagtttaagaccttcttcagacattgtatagcatgtaagactggtcctggacgttgcccc
cattgtaagagagtttggaatctcctcagactccatgcccgcagctgtagagattcccaa
tgcactgtccccaaatgcagagatttcagagagattagtagtaggcagcagcagcagtcg
gacaaaaggcgtagagctgctgtaatggagatgatgcgggaaagggccgctgaagccacc
cgcactggctaa

DBGET integrated database retrieval system