KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_339208Help
Entry
ARALYDRAFT_339208 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ARALYDRAFT_339208
Enzymes [BR:aly01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     ARALYDRAFT_339208
Exosome [BR:aly04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ARALYDRAFT_339208
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 430 aa AA seqDB search
MATTPIFNASCSFPSTRGIDCKNYIGLRSNVSKVSVASSRIATSQRRNLVIRASESGNGH
AKKLGMSDAECEAAVAAGNVPEAPPVPPKPAAPIGTPIIQPLNLSRRPRRNRASPVARAA
FQETDISPANFVYPLFIHEGEEDTPIGAMPGCYRLGWRHGLVQEVAKARAVGVNSIVLFP
KVPEALKNPTGDEAYNDNGLVPRTIRLLKDKYPDLVIYTDVALDPYSSDGHDGIVREDGV
IMNDETVHQLCKQAVSQARAGADVVSPSDMMDGRVGAIRAALDAEGFQNVSIMSYTAKYA
SSFYGPFREALDSNPRFGDKKTYQMNPANYREALIEAREDEAEGADILLVKPGLPYLDII
RLLRDKSPLPIAAYQVSGEYSMIKAGGVLKMIDEEKVMMESLMCLRRAGADIILTYFALQ
AATCLCGEKR
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggctactacaccgatttttaatgcctcgtgtagctttccatcgaccagaggaatcgat
tgtaagaactatattggtctgagatcgaatgtgagtaaagtgagtgtggcttcttctcga
attgcaactagtcaacgtcgtaatcttgtcataagagctagtgaatctggcaatggacac
gctaagaaacttggaatgagtgatgctgagtgtgaagccgctgttgctgctggaaatgtt
cctgaagctcctccggttccacctaaacccgctgctccaattggtacaccgataattcag
cctcttaatctaagccgacgcccacgtcgtaaccgtgcttcccctgtggcgagagccgcc
tttcaagaaactgatatctcccctgcaaattttgtatacccacttttcattcatgaaggt
gaggaagacacgcctattggagctatgcccggttgctatagacttggctggaggcatggt
cttgtacaagaggttgcaaaggctcgagctgttggtgtaaacagtatcgtcctgttccct
aaagttcctgaggctttgaagaatccaacaggagatgaggcatacaatgacaatggtttg
gtgcctcgaacaattcgtcttcttaaagacaaatatcctgatcttgttatctacactgat
gtggctttggatccctactcatccgatggtcacgatggaatagttagagaggatggtgta
attatgaatgacgaaacggtacatcagctgtgtaagcaagctgtttcccaggcccgagct
ggagcggacgttgtcagtccgagtgatatgatggatgggcgagtaggtgcaatccgtgca
gctcttgatgctgaaggatttcaaaacgtctccatcatgtcctacacagccaagtatgca
agttcgttttacggtcctttccgtgaagccctggactccaatccacgtttcggagacaag
aaaacgtatcagatgaacccagcaaattacagagaggccttgattgaggcacgtgaagac
gaggctgagggagcagacattcttctggtgaagccaggtcttccatatttggacatcata
cggcttctgagggacaaatctccattgcccattgctgcataccaagtttctggagagtac
tcaatgatcaaagcagggggagttctgaagatgatcgatgaagagaaagtgatgatggag
tcactgatgtgcttacgccgagctggagcggacatcatcctaacatacttcgctcttcaa
gctgctacttgtttatgcggcgagaagcggtag

DBGET integrated database retrieval system