KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_340799Help
Entry
ARALYDRAFT_340799 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:aly00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 306 aa AA seqDB search
MTDTQIPDNSSSSSNQSPTKPESLRSLEFQLGSSFTADPIIPPPNQIVIVISGPSGVGKD
AVINKLREVREGLHFVVTATSRPMRPGEVDGKDYFFVSRDQFLSMVENEELLEYALVYGE
YKGIPKKQIQEFMAKGEDIVLRVDIQGAQTLRRILGNSAVFIFLVAESELAMVERLIDRK
TESQEELLVRVATAREEVRHLKNFDYVVVNAKGRLDDAVNRVESIIDAEKSKEDLVQLIC
LGSFLQKFLGLAMSFRNYGLGIPNANIACCLQSRFHREPRQFWYLYKGNEHSGDSSLLQG
ILLNQS
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatacccagatccctgataactctagttcgtcctcaaatcaatctcccaccaaa
cccgaatcgcttcgttccctcgaatttcaattgggttcttctttcaccgccgatccaatt
atcccaccgccgaatcagatcgtcatcgttatcagtggtccgagcggagttggcaaagac
gcagtgatcaacaagcttcgtgaggttcgtgaaggtctacatttcgttgttaccgccact
agccgtccgatgcgacctggtgaagttgatggtaaagactatttctttgtctcgagagat
caattcttatcaatggtggagaacgaagagcttcttgaatacgcacttgtttatggagag
tacaaagggattccaaagaagcagattcaggagtttatggctaaaggggaagacattgtt
cttagagttgatattcaaggagctcagacgttaaggaggatacttggtaactctgccgtg
tttatattccttgtggcggagagtgagcttgcgatggtggagaggttgattgatcggaag
acggagagtcaagaggagctgcttgttagagttgctacggcgagggaagaggttaggcat
ctaaagaactttgattacgttgtggtgaatgcaaaagggaggcttgatgatgcggttaat
cgcgtggaatccattatcgatgctgagaaatccaaagaagatcttgtgcagctgatttgt
ttagggagcttcttgcaaaagttcttaggtttggcaatgtcatttaggaactatggtttg
ggtataccgaatgcaaatattgcttgctgtctccagtcacggtttcatcgcgaaccaaga
caattttggtatctgtacaagggaaatgaacattcaggtgattcctccctgttacaagga
atccttttgaatcaaagttag

DBGET integrated database retrieval system