KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_343571Help
Entry
ARALYDRAFT_343571 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K12117  
LOV kelch protein 2
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 607 aa AA seqDB search
MEWDSDSDLSGGDEVAEDGWFGGDNGAIPFPVGSLPGTAPCGFVVSDALEPDNPIIYVNT
VFEIVTGYRAEEVIGRNCRFLQCRGPFAKRRHPNVDSTIVTKMRQCLENGIEFQGELLNF
RKDGSPLMNKLRLVPIREEDEITHFIGVLLFTDAKIDLAPSPDLSAKEIPRISRSFTSAL
PIGERNVSRGLCGIFELSDEVIAIKILSQLTPGDIASVGCVCRRLNELTKNDDVWRMVCQ
NTWGTEATRALESVPGAKRIGWVRLAREFTTHEATAWRKFSVGGTVEPSRCNFSACAVGN
RIVIFGGEGVNMQPMNDTFVLDLGSSSPEWKSVLVSSPPPGRWGHTLSCVNGSRLVVFGG
YGSHGLLNDVFLLDLDADPPSWREVSGLAPPIPRSWHSSCTLDGTKLIVSGGCADSGALL
SDTFLLDLSMDIPTWREIPVPWTPPSRLGHTLTVYGDRKILMFGGLAKNGSLRFRSNDVY
TMDLSEDEPSWRPVIGYGSSLPGGMAAPPPRLDHVAISLPGGRILIFGGSVAGLDSASQL
YLLDPTEEKPAWRILNVHGGPPRFAWGHTTCVVGGTRLVVLGGQTGEEWMLNEAHELLLA
TSTTAST
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atggagtgggatagtgattccgatctcagcgggggagatgaagtggcggaggatggatgg
ttcggcggagataacggagcgattccgtttccggtaggtagtcttcctggaacggcgccg
tgtggttttgtggtcagcgatgctcttgaacctgataaccctatcatttatgttaacact
gtttttgagattgttactggttatcgagctgaggaagttattggtcgaaattgccggttc
ttacaatgtagagggccatttgctaaaagaaggcatccaaatgtagattctacaattgtg
acgaagatgcggcaatgtctagaaaatggcatcgagtttcaaggcgagttgctcaacttt
cggaaagatggatctcccttgatgaacaagctgcgtctagtccctatccgtgaagaagac
gaaatcactcatttcataggcgttctcttattcacagatgcaaaaattgatcttgcccca
tctcctgatttatctgcaaaagaaattccaagaatatctcgctcatttacttctgcttta
ccaatcggagagcgtaatgtttctcgtggactttgtgggatattcgaactgagtgatgag
gtcatagctatcaagatattgtcacagttgactcctggtgatattgcatcggttggttgt
gtatgtcggcggctaaatgagttgacaaagaatgatgatgtatggagaatggtctgtcaa
aacacatggggtacagaggcaacacgtgctcttgagagtgttcctggtgcaaagaggatc
ggttgggtgcgactggcccgagagtttaccacacacgaagcaacagcatggaggaagttt
tcggttggaggtactgttgagccttcccggtgtaatttcagcgcatgtgcagttgggaac
aggattgttatctttggcggggaaggtgtaaatatgcagccgatgaatgatacatttgtg
ttggaccttggctcgagtagccccgagtggaaatccgttctggtcagctctcctccaccg
gggcgctggggtcacacactttcttgtgtcaatggatcccgtttagtagtgtttggaggt
tacgggagccacggattactcaacgatgtgttcttattagaccttgatgcagacccgcca
agctggagagaagtatccggattggcccctccaataccaagatcatggcacagttcgtgc
acacttgatggcactaagctgattgtatcaggtggctgtgctgattcaggagctctactc
agcgatacattcctgcttgacctgtcgatggatataccgacatggagggagataccagtt
ccatggacccctccatctcgcctcggacatactctaaccgtctatggtgaccgcaagatt
ctcatgtttggcggtcttgccaaaaacggttctctgagattccgctctaacgatgtatac
acgatggatcttagcgaggatgaaccgagttggagacctgtgattgggtatggatctagc
ctcccaggaggcatggcagctccaccaccaaggctggatcatgtggcaatcagccttccc
ggtggtcgaatcttgatctttggtggttcggttgcagggcttgactcggcttctcagctt
tatcttcttgatccaactgaggagaaaccggcatggagaatactgaatgttcatggaggt
ccgccaaggtttgcgtggggacacaccacttgtgtggtcggaggaactcggttggtcgtc
ttaggtggtcaaaccggtgaagagtggatgctaaatgaagctcatgaactattattagca
acgtctactactgcaagcacttga

DBGET integrated database retrieval system