KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_344061Help
Entry
ARALYDRAFT_344061 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    ARALYDRAFT_344061
Enzymes [BR:aly01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     ARALYDRAFT_344061
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 542 aa AA seqDB search
MVSPPPTLMVFDDFNNNSYDGGAGPSTGPRKRGRGRPKGSKNGTRKPKKPKAYDPNSKLI
KSCPKFDSGITKAERESGNLEIVASVLMRFDAIRRRLHQVNQPKDILTTASTNCMRLGVR
TNMTRRIGPIPGVQVGDIFYYWGEMCLVGLHRDMAAGIDYLSAKRSGVDGHAATSVVTSG
QYDDETEELDTLIYIGQDGKGKNRQPCDQHVIGKSGFKEFRFKLVRKPDQPSGYAIWKSV
EILRNHDLIDPRNGSILGDLSFGAEVLRVPLVNEVDEDDKTIPEDFDYIRSQCYSGMMFD
LNVDIQSLGCQNCESCSHQNCSCMGKNGGELPYHNNILVSRKPLIYECGGSCPCPIDCPN
RLVQTGLKLHLEVFKTANCGWGLRSWDPIRAGTFICEFAGVSKTKEEVEEDDDYLFDTSR
IYHTFIWNYEPQLLREDASKQVSEVINLPTQVLISAKEKGNVGRFMNHSCWPNVFWQPIE
YEDNGVTYVRIGLFAMKHIPPMTELTYDYGVSCVEKNGEDEILYKGKKICLCGSVKCRGS
FG
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggtctcaccacctccaaccctaatggtatttgatgacttcaacaacaactcttatgat
gggggtgctggtcctagtactggtccaagaaaacgaggacgtggccgaccaaagggttca
aaaaacgggacgagaaagccaaagaagccaaaagcatatgatcctaatagcaaactgatt
aaatcttgtccaaaatttgattcagggataaccaaagcagagagagaaagcggaaacctt
gagattgttgcttcggtgttgatgcggtttgacgcgattagacggcgattacaccaagta
aaccagccaaaagacatccttacaacagcgtcaactaattgcatgagattgggagtccgg
acaaatatgacgagaagaattggtccaattcctggagtacaagtaggcgatatattctac
tactggggtgaaatgtgcttagtcggtcttcacagagacatggccgcgggcattgattat
ctgtcagctaaaaggagtggagtggatggtcatgctgctacgagtgtggtaacatcagga
cagtacgatgatgaaaccgaggagcttgacactttgatctatatcggacaagacggaaag
ggcaagaaccgtcaaccatgtgatcagcatgtgataggaaaatctggctttaaggagttc
agattcaaattggtgaggaaaccagaccaaccatctggttatgcaatctggaaatcagtt
gaaattttgaggaaccatgacttgattgatccaagaaatggttctatacttggagatctt
tcttttggagcagaggttttacgagttccgctcgttaatgaagttgatgaagatgacaaa
acgattcctgaagattttgactacattagatctcagtgttactcaggtatgatgtttgat
cttaatgttgatattcaatcacttggatgccagaattgtgagtcatgcagtcatcaaaac
tgctcgtgcatgggtaaaaacggtggcgagctaccataccataacaacattttggtttct
cgtaaaccattgatttacgagtgtggtggatcttgtccctgccccatcgattgcccaaac
cgattggttcaaaccggtttgaagctccacttggaagtgttcaaaacagcaaactgtggt
tggggtttacgttcttgggatccaatccgagcgggaacttttatctgcgagtttgccggt
gtgagcaagacaaaagaagaagtagaagaggatgacgattacttgttcgacacatctcgg
atttatcataccttcatatggaactatgaacctcagcttttgcgtgaagatgcttcaaaa
caggtctctgaagttatcaatcttccgacacaagtcttgataagtgccaaggagaaagga
aatgtaggtcggttcatgaaccacagctgttggcccaatgttttttggcagcctattgaa
tatgaagacaacggtgttacatatgttcgcattggactttttgcaatgaagcatattcct
ccaatgacagagttaacatatgactatggagtttcttgtgtggagaagaatggagaagat
gagatactttataaaggcaagaagatttgtctatgtggttcagtcaaatgtcgtggctct
tttggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system