KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_351685Help
Entry
ARALYDRAFT_351685 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:aly03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1247 aa AA seqDB search
MCQNQCEESLSRDVRMIVFPKDRRGHLMVLCLSSKQVVELQICFRKSLKSLSFNCHVSIW
RKWNRSSWTWQWTHYKTTKSLRHTIELASRVHEGTKKDCLYLDVELGTFKFRTYVPGLVI
RSGPDTEVYWNDARQKKPEPVHKRPLPSSELMMFSSYAVVAESYVQWSPLGTYLVTLHKQ
GAAVWGGTDTFTRLMRYQHSMVKLVDFSPGERYLVTYHSQEPSNPRDASKVEIKVFDVRT
GRMMRDFKGSADEFSIGGPGGVAGASWPVFRWAGGKDDRYFAKLSKNTISVYETETFSLI
DKTSMKGGGNQPAKVALVQIPSKVELRQKNLFSVSDCKMYWQSSGEYLAVKVDRYTKTKK
STYSGFELFRIKERDIPIEVLELDNKNDKIIAFAWEPKGHRFAVIHGDQPRPDVSFYSMK
TAQNTGRVSKLATLKAKQANALFWSPTGKYIILAGLKGFNGQLEFFNVDELETMATSEHF
MATDIEWDPTGRYVATAVTSVHEMENGFTMWSFNGNLVYRILKDHFFQLAWRPRPPSFLT
AEKEEEIAKNLKKYSKKYEAEDQDVSLLLSEQDREKRRALKEEWEKWVMQWKSLHEEEKL
ARKNLRDGEVSDVEEDEYEAKEVEFEDLIDVTEEIVQESIDSSVFALQNMEEVADPVNSV
TLTLHDDKQCALWDCMRVHADGSRYCCIPHMDFALAERTIQRPHNMANVRSFIQLDKLVI
PKLVNHLRNPALGITGISNLQHLNVLNASPLDQHIRFPTDLDEREEFNIWVFIWRFVPNR
QLWRQGNDTRRGNYVRTRFYRLFPAVGGTSWRLFRYTINSNTVALYAMEYCKSLAHPPPV
VGVYYRRTCVNASDGVEYLNSATVTDLHSSKNKTEQNEMHSEFLANKGVQHHTPARDLMA
YSDGMISPELLSVRNKSPNENPNWISDPERMVNSGNEKSIRISGLRSRPWDEIRNAANKR
KTPPCSHELHPKSKARKQKPDAERAAKRELLRGVSKNVYKQKRPSSIFMEKSVVLPDFEF
QSPVFRYEAPISSPSPSFTKRTSKETTCQARRFPDFSGKTRDYYFGREFSGDDLGDSDML
AYYNSLEEREAASANLKDNGHVVISPSSLISKVIHITPSSQHSEMDEEEVFGRAVALFIM
AFQKFEKKLKLAAEKKCSEIIASVSEEIHLEGKEDELPRQNSRKDTKNSLIVSTSLNSRG
HQILKHLEGTIKTKLDNASKRIEYVNNCAKRLKRDLKKSVREYLMED
NT seq 3744 nt NT seq  +upstreamnt  +downstreamnt
atgtgccaaaaccagtgtgaagaaagcttgtctcgagatgtgaggatgatagttttccca
aaagaccgtcgtggccatctgatggttctatgtttgagctccaaacaagtggttgagctt
caaatatgctttcgtaaatcactaaagtcattgtcatttaactgtcatgtgagcatatgg
aggaaatggaacagaagttcttggacgtggcaatggacccactacaagactactaagagt
ctaagacacaccattgaattggccagtagagttcatgagggtacaaagaaagattgcttg
tatttggatgtagaacttggtacgtttaagttcaggacctatgtccctgggctagtcatt
cgttctggccctgatactgaagtttactggaatgatgcaaggcagaagaagcctgaacct
gttcataagcgtcctttaccatcatctgaattaatgatgttctcttcctatgcagttgtg
gcagagagttatgtgcagtggtctcctttaggtacataccttgtgacacttcacaagcag
ggggcagctgtttggggtggtactgatacattcacgcgtctcatgcgttatcagcattct
atggtcaaacttgttgatttctcgccaggtgagagatatcttgtaacttaccatagccaa
gaaccaagcaatccgagagatgcaagtaaagtagagattaaggtctttgatgtgagaacc
gggaggatgatgagagatttcaagggtagtgctgatgagttttcaattggaggacctggt
ggtgttgctggcgcctcttggcctgttttcagatgggctggtggaaaagatgatagatac
tttgccaagcttagcaaaaacaccatctctgtctatgagactgagactttcagcctaata
gacaagacatccatgaagggtggtggaaaccaacctgctaaggttgctctagtccaaatc
ccgagcaaggtggagctgaggcagaagaatctcttcagtgtgagcgactgcaagatgtac
tggcagagtagtggagagtatcttgctgttaaggttgatcgatacacaaaaactaagaag
agcacatactctggatttgagcttttccgtatcaaagaaagggatattcccatcgaggtt
cttgagctggataacaagaacgacaagatcattgctttcgcttgggagcccaagggtcac
aggtttgctgtgattcatggtgaccaaccaagaccagatgtcagtttctactcgatgaag
accgcacaaaatactggaagggtttcaaagctcgcaacgttgaaggccaaacaagccaat
gccctcttctggtcgcccacaggaaagtacatcattcttgctgggttaaaaggtttcaat
ggccagcttgaatttttcaacgtggatgagctcgagacaatggcaacatctgaacacttc
atggccacggatatcgaatgggacccaactggaaggtacgttgcaaccgcagtgacatca
gttcacgagatggagaatgggttcaccatgtggtctttcaacgggaatttggtttaccgg
atactgaaggatcatttcttccagttggcttggcgtccaagaccgccatcattcttaact
gcagagaaggaagaagagatagcaaagaacctgaagaagtacagcaagaagtatgaggca
gaggatcaggacgtatcgttgctgttgagtgaacaagacagagagaagaggagggcattg
aaggaagaatgggagaaatgggtgatgcagtggaagtctctgcatgaagaggagaaactc
gcgagaaaaaatcttcgggatggtgaagttagtgatgtggaagaagatgagtatgaagcc
aaagaagttgagtttgaggatcttattgatgtcactgaggaaatcgttcaagagtcgata
gattcgtcggtctttgcactacagaatatggaagaggttgctgatcctgttaatagtgtt
acccttactttgcatgatgataagcaatgcgcgttatgggactgtatgcgtgtccacgca
gatggttctcggtattgctgcataccacacatggactttgcccttgcagaaaggaccatt
caacgaccacataacatggccaatgttcgttcgtttatacagttggataagcttgttatt
ccaaaactcgtcaaccatttaagaaacccggcactcggtatcactggaatatccaatcta
caacatctaaacgttctgaatgcctctccccttgaccaacacatacggttcccaactgat
cttgatgagagggaagagtttaatatttgggttttcatttggcgatttgttcctaaccga
cagctatggcgtcagggaaatgatacacgtcgagggaactatgtcagaacgcgtttctat
cgactcttccctgcggttggtggaacatcgtggaggttatttaggtacacaatcaacagt
aatacagttgcactttacgcaatggagtactgtaagtcactcgctcatccaccgcccgtc
gttggcgtctattacaggagaacttgtgtcaatgcttctgatggagtagaatatttgaat
tcagccacagtaactgatttacactcgagcaagaacaagacggaacaaaacgagatgcat
tcagaatttctggccaacaagggagtacagcatcatacaccagctcgggacttaatggcc
tacagtgatggtatgataagtcccgagctgctgtcggttaggaacaaatcgccaaatgaa
aacccaaattggatctcagacccagagaggatggttaattcagggaatgaaaaatccata
aggatttctggtctaagatcaagaccgtgggatgagattaggaatgcagcaaacaagagg
aaaactccaccttgttcccatgagcttcatccgaagagcaaagccaggaaacaaaaacca
gatgctgaaagagctgctaagagagagttgttacgtggagtctctaaaaatgtctataaa
cagaaaaggccgagtagtattttcatggaaaagtctgttgtgctgccagatttcgaattc
cagagcccagtgtttcgatatgaagcaccaatctcaagtccttccccatcttttactaaa
agaacatctaaagagacaacatgccaagcaaggagattccctgacttctcggggaagaca
agagattattacttcggaagagaattttctggcgatgacttaggtgattcagatatgttg
gcttattacaacagtcttgaagaaagagaagctgcctcagctaatcttaaggacaatggt
catgtagtgataagtccttcctctttgatttcgaaagtgatccatattactccttcctcc
cagcattcagagatggatgaagaggaagtctttggaagggctgttgcattgttcattatg
gcttttcaaaagttcgagaaaaaactgaaactagcagctgagaagaaatgctcagaaatt
atagcatcggtctccgaggagatacatctagaggggaaagaagacgagttacctcgccaa
aactcaaggaaagacaccaaaaactctctcatagtttccacaagcctaaactcacgagga
caccaaatactcaagcatctagaaggaaccatcaagacaaagctggacaatgcctccaaa
agaatcgagtatgtcaacaattgtgcaaaaagattgaagagggatttgaagaagagcgtt
cgagagtatttgatggaagactaa

DBGET integrated database retrieval system