KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_352131Help
Entry
ARALYDRAFT_352131 CDS       T01578                                 

Definition
ubiquitin carboxyl-terminal hydrolase family protein
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Brite
Enzymes [BR:aly01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     ARALYDRAFT_352131
Peptidases [BR:aly01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   ARALYDRAFT_352131
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 913 aa AA seqDB search
MTIPNSDFMIENGVCDFPTTPAEEKRIVSELITESEDNLKEGNLYFVISKRWYASWQKYV
EQSTNECLSGESSRPGAIDNHDIIESESDANDPQLRRLLVEGVDYVLVPQEVWKRLVEWY
SGGPPIERKLICQGFYSRSYSVEVYPLCLMLTDGRDESRTTIRLGKQTSIRELCEKVCTM
TGVAQEKAHIWDYFHKRKNGLLDPSSNKSLEESSLQMDQDILLEVDGSSSSQYAISSAGN
ELALVPLEPSRSRVTIAGGPTLSNGHSTSSKFSLFPRITSEDDGCNSLSILGKGEKGGLA
GLSNLGNTCFMNSALQCLAHTPPIVDYFLQDYSDDINRDNPLGMCGELAIAFGDLLKKLW
SSRNAVAPRSFKTKLARFAPQFSGYNQHDSQELLAFLLDGLHEDLNKVKRKPYIELKDSD
SRPDDEVAEELWNYHKARNDSVIVNVCQVFDFFQGQYKSTLVCPVCGKISITFDPFMYLS
VPLPSTLTRSMTVTVFYCDGSRLPMPYTVTVPKHGSIRDLITALGTACCLADDESLLLAE
VYDHKIFRYFENPLDSLSAIKDDEHIVAYRLNQMPKGSGNAKLEILHGGLERDVLESVRG
RDVKLFGTPLVTYVNTDPLSGTDIDAVISGFLSPLHRVHASSKIHNGSDNGHLADATTDE
TSASLSSPDTEIDDASDGQLSFRIFLTDERGLNYKPLQSESSVSPGTITKVLVEWNEGEH
ETYDSSYLNDLPEVHKTSFSAKKTRQEAISLFSCLEAFLAEEPLGPDDMWFCPSCKEHRQ
ANKKLDLWKLPDILVFHLKRFTYSRYLKNKIDTFVNFPIQDLDLSKYVKNKNGQSYLYEL
YAISNHYGGLGGGHYTAYAKLIDDNKWYHFDDSHVSSVNESEIKNSAAYVLFYRRVGSET
ETQTAEMSRSDMD
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atgacgatccctaattccgatttcatgattgaaaacggagtctgtgattttccgactact
cctgccgaagagaaacgtattgtatcggagctgattaccgaatcggaagataatttgaaa
gaaggaaacttgtattttgtcatctctaaaaggtggtatgcaagctggcagaaatatgtt
gagcaatcgacaaatgaatgtctaagtggggagtcctcgaggcctggagcgattgataac
catgatattatcgaaagtgaaagcgacgcgaatgatccacagcttcgtagattgttggtg
gaaggggttgactacgttttagttcctcaagaagtttggaaaagacttgttgaatggtat
agcggaggtcctccgatagaaagaaagttgatctgtcaaggcttttatagtaggagttat
agtgtagaggtttacccactctgccttatgttgacagacggacgagatgagagtagaact
acaatacggttgggaaaacaaacctctataagggaactttgtgagaaggtttgcactatg
acaggggtagcgcaagaaaaggctcacatatgggattatttccataagaggaaaaacgga
ctcttggatccttcatctaacaagagcctggaagagtctagccttcagatggaccaagat
attcttcttgaagttgatgggtcgtcttcctctcaatatgctattagctcggcaggaaat
gagttagctctggtacctctggaaccgtcaaggtcgcgtgttacaattgctggggggcct
accctatcaaatggtcattccacttcgtccaagtttagtctctttccgagaataacttct
gaagacgacggctgcaattctttgagtattcttggaaaaggagaaaagggaggattagca
ggattgagtaatttgggaaatacctgctttatgaatagcgctcttcagtgtttggcccac
acacctccaattgttgactacttcttgcaagattacagtgatgacataaatagagataat
cctttgggaatgtgtggtgagcttgctatcgcatttggtgatttgttgaagaaattatgg
tcatcaaggaacgcagttgcaccacgctcttttaagacaaaattggctagatttgctcca
cagtttagtggttacaatcagcatgattctcaagaactgcttgctttcttattggatggg
ctgcatgaagatttgaataaggtcaaacgaaaaccttacattgaacttaaagattctgac
agtcgtccggatgatgaagttgctgaagagctttggaattatcataaggcccgaaatgat
tctgtaatagttaacgtctgtcaagtattcgatttctttcagggccaatacaagtcaact
ctggtttgtccagtttgcggaaaaatatcaatcacttttgatcccttcatgtacttgtct
gtacctttgccatcaacacttacgcgatccatgacagttacggtgttttattgtgatgga
agtcgtcttccgatgccatatacggtaacagtgcctaaacatggatctattagagatctc
attaccgcattaggtactgcttgctgtctagccgatgatgagagcctattacttgcagag
gtatatgatcacaagatctttagatattttgagaatcccctggattcactgagcgcgata
aaagatgatgagcatattgtggcgtatcggttaaatcagatgccgaaaggatcaggaaat
gcaaaactcgagattcttcatggagggctggaaagggatgttctggagagtgttagaggc
agagacgtgaagctttttggaactcctttagtgacttatgtcaacacagacccactaagt
ggaactgacattgatgcagttatctctggatttctgtcacctctgcacagggtccatgcc
tcgtctaagattcataacggaagtgacaatggccaccttgctgatgctactactgacgaa
acatccgcaagtttatcatccccagataccgagatagacgatgcatctgatggacagtta
tccttcaggatattcttgacagatgaacgtggtttgaactataaaccacttcagtctgaa
tcttctgtgagcccgggtaccattacaaaagttttagtcgagtggaatgagggtgagcat
gaaacatatgattccagctacttgaatgatcttccggaggttcataaaacaagtttctct
gcaaagaagacaagacaagaagcgatatccctgttttcgtgtttggaggcctttttagca
gaagaacctctgggaccagatgatatgtggttttgtccgagctgcaaagaacacagacaa
gcgaacaaaaagctagacctgtggaagttgcccgatatccttgtgttccatttaaaacgg
ttcacatatagcagatatctcaagaacaagattgatacgtttgtgaatttcccaattcag
gatctagacttgagcaagtacgtgaaaaacaagaatggccagtcatatctatatgaacta
tatgccattagtaatcattacggtggacttggtggtggtcattacactgcgtacgcgaag
ttgattgatgacaacaaatggtatcatttcgatgatagtcacgtttcatcagtaaatgaa
tctgaaatcaaaaactcagctgcatatgtactgttctaccgaagagtgggaagtgaaaca
gagacacaaacagctgagatgtcgaggagtgatatggattag

DBGET integrated database retrieval system