KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_356260Help
Entry
ARALYDRAFT_356260 CDS       T01578                                 

Definition
palmitoyl protein thioesterase family protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    ARALYDRAFT_356260
  Lipid metabolism
   00062 Fatty acid elongation
    ARALYDRAFT_356260
Enzymes [BR:aly01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     ARALYDRAFT_356260
Lipid biosynthesis proteins [BR:aly01004]
 Fatty acid synthase
  Component type
   ARALYDRAFT_356260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 313 aa AA seqDB search
MEKGLKRSCVMVVVAFLAMVHVSLSVPFIILHEIGTQCSDATNANFTQLLTNLSGSPGFC
LEIGNGISDSWLMPLTRQAEIACDNVKQMEELSLGYNIVGRAQGNLVARGLIEFCDGGPP
VYNYISLAGPHAGIAAFPPCNSGGICNITNEIINGDVYSDFAQDNLAPSGYYKNPHNVTE
YLKGCKYLPKLNNERPDQRNQTYKDRFTSLQKLVFVLFQNDTVIVPKESSWFGFYPDGDL
THVLPVSQTKLYIEDWIGLKALARAGKVQFVIVPSAHLIIADEDLVNYVVPLLEDQVSAA
PRLNRKTKEPLHP
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaggtttgaagcggtcttgtgttatggtggtggttgcattcttagctatggtt
catgtctctctttcagttccgttcataatacttcatgaaatcggaactcaatgttctgat
gctacaaatgctaacttcacacagcttctcactaacctctctggctctcctggcttttgc
ttagaaattggcaatggaataagcgattcatggttaatgccacttacacgacaagcggaa
atagcgtgtgataatgtgaagcaaatggaagagttgagtctaggatacaacattgttgga
agagctcaggggaacctagtggctcgaggcttgatcgagttctgcgacggtgggcctcct
gtttacaactatatatccttggctggtcctcatgctggcatcgccgcttttcctccgtgt
aattctggtggcatttgtaacataacaaatgagattatcaatggagatgtctatagcgac
tttgctcaagataatcttgctcctagtggttattacaaaaaccctcataatgtgacagag
tacctgaaaggttgtaagtatctacctaagcttaacaatgagagaccggaccaaagaaac
caaacttacaaagaccgtttcaccagtttacagaagctggtttttgtcctgtttcagaac
gatacggttattgtcccaaaagagtcatcttggttcgggttttatccagatggtgactta
acacatgttctccctgtgtcccagacaaagctctatatagaggattggataggtctgaaa
gcattggctcgtgctggaaaagtgcagtttgtgattgtacccagtgcccacttaataatt
gcggatgaagatctcgtcaactacgtcgtacctcttctcgaggaccaagtgtctgccgca
ccaagactcaaccgcaagaccaaggagcccttgcatccttaa

DBGET integrated database retrieval system