KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_359227Help
Entry
ARALYDRAFT_359227 CDS       T01578                                 

Definition
dihydroflavonol reductase
Orthology
K13082  
bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase [EC:1.1.1.219 1.1.1.234]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Flavonoid biosynthesis, naringenin => pelargonidin
Class
Metabolism; Biosynthesis of other secondary metabolites; Flavonoid biosynthesis [PATH:aly00941]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 384 aa AA seqDB search
MVSQTETVCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTQLTL
WKADLSEEGSYDGAITGCDGVFHVATPMDFESKDPENEVIKPTVNGMLGIMKACVKAKTV
RRFIFTSSAGTVNVEEHQKSVYDENDWSDLEFIMSKKMTGWMYFVSKTLAEKAAWDYAEE
KGLDFISIIPTLVVGPFITTSMPPSLITALSPITRNEAHYSIIRQGQYVHLDDLCNSHIF
LYEQETAKGRYICSSHDATILTISKLLRQKYPEYNVPSTYEGVDENLKSIEFSSKKLTDM
GFNFKYSLEEMFIESIETCRQKGFLPFSLPYQSISENKGPTKDDNIELKAGDGLTDGMMP
CNKIEPGLTGERTDAPMPAEQMCA
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggttagtcagacagagaccgtgtgtgtaacgggcgcttcgggattcatcggttcatgg
ctagtgatgcgattactcgaacgtggttactttgttcgtgccactgtgcgcgatcctggg
aatttgaagaaagtgcaacatcttcttgatttgccaaatgccaagacgcaactcacttta
tggaaggctgatttatctgaggaaggaagctacgatggcgccataactggatgtgacggt
gttttccacgtggcaactcccatggattttgaatcaaaagatcctgagaacgaagtgata
aaaccgacagtgaatggaatgttggggattatgaaagcatgtgttaaggcaaagactgta
cgaagattcatatttacttcatctgctggaactgttaatgtagaagaacatcagaagagt
gtctacgatgaaaacgattggagcgatcttgagtttatcatgtccaaaaagatgacagga
tggatgtattttgtgtcgaaaacattagccgagaaagcagcgtgggattacgccgaggaa
aaaggattagatttcattagtattattccaacattggtggtcggtccatttataacaaca
tctatgccgcctagcctcatcaccgcgctctctcctatcactcggaacgaggcacattac
tcgattataagacaaggacagtatgtgcatttggacgacttatgcaactctcatatcttc
ttatacgaacaagaaactgccaaaggacgttatatttgttcctctcacgatgctacaatt
cttactatctcaaaacttctcaggcaaaaataccccgaatacaacgtgccttcaacgtat
gaaggtgtggatgagaatctaaagagcattgagttcagttccaagaagctgactgacatg
gggtttaacttcaagtatagtctcgaggaaatgtttattgagtctattgagacatgtcgt
caaaagggttttctcccgttttctttaccgtaccaatccatatcggagaacaaaggtccg
acgaaggatgacaatattgagctcaaagccggagatggtttaaccgatggtatgatgcca
tgtaacaagatagaaccggggctaaccggcgagagaaccgatgctcccatgccagcagaa
cagatgtgtgcttag

DBGET integrated database retrieval system