KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_470654Help
Entry
ARALYDRAFT_470654 CDS       T01578                                 

Definition
(RefSeq) fatty acid desaturase family protein
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 299 aa AA seqDB search
MCDPIREDGSSQRGALSKEKRPYIHREWSWADIIRALTVMVVHFLCLLAPFNYKWEALRF
GLVLYALTSLSITFSYHRNLAHRSFKLPKWLEYPLAYFAVFALQGDPLDWVSIHRFHHKF
TDSDRDPHSPIEGFWFSHVWWICDTRYIKYKCGGRNNVMDLKQQWFYRFLRMTIGFHVLM
FWTVLYLYGGLPYLTCGGGVGGVIGYHVTWLVNSACHIWGSRSWKTKDTSRNVWWLSLFT
MGESWHNNHHAFESSARQGLEWWQIDITWYLIRLFEVLGLATDVKLPSEFQKRKLALIR
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgatcccattagagaagatggctctagccaaagaggcgccttgagtaaggaaaaa
aggccgtatattcatagagaatggtcgtgggctgatataataagagcgttaaccgttatg
gttgtgcactttttgtgtctcttggcaccgtttaactacaaatgggaagctttacggttc
ggtttggtgctttacgcattgacttcactcagcattacattctcataccataggaacttg
gctcaccggagcttcaagcttccgaaatggcttgaatatcctttagcttattttgctgtt
tttgctcttcagggtgatccgttggattgggtgagcatacataggttccatcacaagttc
actgattctgaccgcgacccacatagccctatcgaaggattttggttcagtcatgtgtgg
tggatatgtgacactcgttatatcaaatataagtgtggaggacgtaacaacgtgatggac
ttgaagcagcaatggttctacaggtttctacgaatgacaattggtttccacgtcttaatg
ttttggactgtcctctatctctatggtggtttaccttaccttacatgcggcgggggcgtt
ggaggtgtgattgggtaccacgtgacatggctcgtaaactcggcatgccatatttggggt
tcgaggtcatggaagactaaagacacatctcgtaacgtttggtggctaagcttatttaca
atgggagagagttggcataataatcaccacgcgtttgagtcatcagcgaggcaaggattg
gagtggtggcaaatagatatcacttggtatctcattcgactatttgaggttctcggatta
gccactgatgtgaaattgccctcggaatttcagaaacggaaattggctctgattcgttga

DBGET integrated database retrieval system