KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_470878Help
Entry
ARALYDRAFT_470878 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Brite
Exosome [BR:aly04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ARALYDRAFT_470878
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 204 aa AA seqDB search
MAPRKPKVVSVTKKKKVVEETIKVTVTEGEDPCVTTETANDQETQDLTFSIPVGENVTTV
EIPVEVRDEQSPQPPETPASKSEGTLKKTDTVEKKKKKKKKKKRDDLAGDEYRRYVYKVM
KQVHPDLGITSKAMTVVNMFMGDMFERIAQEAARLSDYTKRKTLSSREIEAAVRLVLPGE
LSRHAVAEGSKAVSNYVGYGSRKR
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgagaaaaccaaaggtggtttccgtgacgaagaagaagaaagtagtggaagag
acaatcaaagtaaccgtcacggaaggagaagatccgtgtgtgaccaccgagacagcaaac
gatcaagagacgcaagatctcactttctctattcccgtcggagaaaacgttactacggtt
gagattccggtggaggttcgagatgaacagtcacctcagccaccggaaactcccgcttcc
aagagtgaaggcactttgaaaaaaacagatacggttgagaagaagaagaagaaaaaaaag
aagaagaagcgagacgatttggcaggagatgagtataggagatatgtgtataaagtgatg
aagcaagtgcatccggatttagggataacgtcaaaggcgatgacggtagtgaacatgttc
atgggagatatgttcgagagaatagcgcaggaggcggcgaggttaagtgattatacgaag
cggaagacgttgtcgtcgagggagatcgaagcagcggtgaggttggttctccctggtgaa
cttagccgccacgccgtcgctgaaggctctaaagctgttagtaactatgttggttatggt
agtaggaaacgttag

DBGET integrated database retrieval system