KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_471294Help
Entry
ARALYDRAFT_471294 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:aly01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:aly00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:aly00400]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 465 aa AA seqDB search
MSSGKIQVRGQPLPRVPARNHHMTHLLVCDVSTKRYHREINAISRNRSPSLDSVPTRTDK
RQFLRGDGNGKFGRFGGKFVPETLMSRLIELEDEFNFVMSDHEFQEELTTSLRDYVGRET
PLYFAERLTEHYKNIVPTIEGGPEIYLKREDLSHCGSHKINNALAQAMISRRLGCSRVVA
ATGAGQHGVATAAACAKLSLECTVFMGATDIEKQSFNVRSMKLLGAQVKSVEGTFKDASS
EAIRNWVENLYTTYYLSGTVVGPHPYPIIVREFQSVIGKETRRQANQLWGGKPDVLVACV
GSASNALGLFHEFVGDKDVRLVGIEAAGLGLDSGKHSATLAVGDVGVYHGSMSYLLQDDQ
GQILKPHSVGVGLEYPGVGPEISFMKETGRAEFYTATDEEAIQACMRLSRLEGIIPALEA
SHALAFLDKLVPTLRDGAKVVVNCSGRGDKDLDTLIQRGMPSSLC
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccggtaaaatccaggtacgagggcagccacttcctagggttccagcaagaaac
caccatatgacacacttgcttgtttgcgacgtttccacaaaacgctaccaccgtgaaatc
aacgcaatcagccgtaatagaagtccatcgttggattcggtcccaacaagaaccgacaag
aggcagtttcttcgtggtgacggcaacggtaaattcgggaggttcggtgggaagtttgta
ccggagacattgatgtctcgcctgatagaacttgaagacgaatttaattttgttatgagc
gatcacgaatttcaggaggagcttaccacatcgttaagagactacgtaggaagagaaacg
cctctctacttcgccgaacgtctaaccgaacactacaagaacatagttccaaccatcgaa
ggtggacctgagatatacctgaaacgggaagatcttagccactgtgggtctcacaaaatc
aataatgctctcgctcaggccatgatttcccggcggcttggttgcagccgtgtggtggcg
gccactggagccggacaacatggagtcgccacagcggctgcatgtgccaagctctccttg
gagtgtaccgttttcatgggagctactgatatagagaaacaatcctttaatgtacgttcc
atgaaactccttggtgctcaggtgaaatcagtggaaggaacattcaaagatgcaagttca
gaagctattcgaaactgggtcgaaaacctatataccacatactacttatcgggtactgtg
gtaggaccgcatccgtatccgataatagtacgtgagtttcaatctgtgatcgggaaagag
acaagaaggcaagccaatcaactctggggtggtaagcctgatgtattggtggcttgtgtg
ggaagtgcctccaacgcattgggtttgttccatgagtttgttggggataaggatgtgcgg
ttagtcggtatcgaggctgcggggctcggtctggattcggggaaacattcagctactttg
gccgttggagatgttggtgtataccatggttccatgagctatttattgcaagatgatcaa
ggacagatacttaaaccacactccgtaggagttgggttagagtatccaggagttggaccg
gagattagtttcatgaaagaaactggcagagccgagttctatacagcaacagacgaagaa
gccattcaagcgtgcatgcgattaagcagattggagggaataataccggcactggaagcg
tctcacgcgctcgcgttcctcgacaaactcgttcctactctgcgcgatggagccaaggtg
gtcgttaattgcagtggccgtggtgacaaagatttagatactctcatccaacgaggcatg
ccctcttctttgtgttga

DBGET integrated database retrieval system