KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_472021Help
Entry
ARALYDRAFT_472021 CDS       T01578                                 

Gene name
AT_CDCKD_3
Definition
cyclin-dependent kinase D1_3
Orthology
K02202  
cyclin-dependent kinase 7 [EC:2.7.11.22 2.7.11.23]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:aly03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:aly03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 393 aa AA seqDB search
MPEMEQPKKVADRYLKQEVLGQGTYGVVFKATDTKTEQTVAIKKIRLGKQREGVNITALR
EIKMLKELKHPHIILLIDAFPHKENLHLVFEFMETDLEAVIRDSNIFLSPADIKSYLLMT
FKGLAYCHDKWVLHRDMKPNNLLIGVDGQLKLADFGLARIFGSPNRKFTHQVFARWYRAP
ELLFGAKQYGAAVDVWAVGCIFAELLLRRPFLQGNSDIDQLSKIFAAFGTPKADQWPDVT
KLPDYVEYQFVPAPSLRSLFPAVSEDALDLLSKMFTYDPKARISIKQALEHRYFTSAPAP
TDPAKLPKPVHKQDGKSSYGKHEAITVLSPPRKLRRVMPERGRVDSLKAHVDKDQQAPMS
LDFTILAERPPNRPTITSADRSHLKRKLDLEFQ
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgccggagatggagcagccaaagaaagttgctgataggtatctcaagcaagaggttctt
gggcaaggtacctatggagtcgtcttcaaggccactgatactaagacggaacaaactgta
gcaatcaagaagataaggcttggtaaacaaagggaaggtgtaaatattacagctctcagg
gaaatcaaaatgctcaaagagctcaagcatcctcatataattctgctcattgatgcattt
cctcacaaggaaaacttgcatcttgtctttgagttcatggagactgacctcgaagctgtc
atccgcgattccaacatattcctctcacccgccgacatcaaatcttacctcctaatgaca
tttaaaggacttgcttattgccacgataaatgggttttgcacagggatatgaagccaaat
aacttgttaataggagttgatggacaactgaagcttgcagattttggcttagcacgtata
tttggtagtccaaatcgtaaatttacccaccaggtgtttgctagatggtacagagcacca
gaacttttgtttggtgcaaaacaatatggtgctgcagttgatgtttgggccgttggctgc
atattcgccgaacttctactacgcagaccatttcttcagggaaacagtgatattgatcaa
ttaagcaaaatatttgctgcttttgggacaccaaaagcagatcagtggccggatgtaaca
aagcttccagattatgtagagtatcaatttgtccctgcaccgtctctacgttctttattc
ccagcagttagtgaagatgctctcgacttgttgtccaaaatgtttacctatgacccaaag
gccagaatttccataaagcaggctctagaacacagatacttcacttctgcacctgctcct
actgacccggctaagctcccaaagcccgttcataagcaggatggtaaatcctcttacggt
aaacatgaggccattacagtgctatcaccaccacgtaagcttagaagagtgatgcctgag
cgtgggagggttgatagtttgaaggctcatgttgacaaggatcaacaagcacccatgtca
ttagattttaccatcctcgctgagcgacctccaaaccggccaacaatcaccagtgctgat
agatctcatctgaagaggaaactcgatcttgagttccaataa

DBGET integrated database retrieval system