KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_472021Help
Entry
ARALYDRAFT_472021 CDS       T01578                                 

Gene name
AT_CDCKD_3
Definition
cyclin-dependent kinase D1_3
Orthology
K02202  
cyclin-dependent kinase 7 [EC:2.7.11.22 2.7.11.23]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:aly00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    ARALYDRAFT_472021 (AT_CDCKD_3)
  Replication and repair
   03420 Nucleotide excision repair
    ARALYDRAFT_472021 (AT_CDCKD_3)
Enzymes [BR:aly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     ARALYDRAFT_472021 (AT_CDCKD_3)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     ARALYDRAFT_472021 (AT_CDCKD_3)
Protein kinases [BR:aly01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   ARALYDRAFT_472021 (AT_CDCKD_3)
Transcription machinery [BR:aly03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     ARALYDRAFT_472021 (AT_CDCKD_3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 393 aa AA seqDB search
MPEMEQPKKVADRYLKQEVLGQGTYGVVFKATDTKTEQTVAIKKIRLGKQREGVNITALR
EIKMLKELKHPHIILLIDAFPHKENLHLVFEFMETDLEAVIRDSNIFLSPADIKSYLLMT
FKGLAYCHDKWVLHRDMKPNNLLIGVDGQLKLADFGLARIFGSPNRKFTHQVFARWYRAP
ELLFGAKQYGAAVDVWAVGCIFAELLLRRPFLQGNSDIDQLSKIFAAFGTPKADQWPDVT
KLPDYVEYQFVPAPSLRSLFPAVSEDALDLLSKMFTYDPKARISIKQALEHRYFTSAPAP
TDPAKLPKPVHKQDGKSSYGKHEAITVLSPPRKLRRVMPERGRVDSLKAHVDKDQQAPMS
LDFTILAERPPNRPTITSADRSHLKRKLDLEFQ
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgccggagatggagcagccaaagaaagttgctgataggtatctcaagcaagaggttctt
gggcaaggtacctatggagtcgtcttcaaggccactgatactaagacggaacaaactgta
gcaatcaagaagataaggcttggtaaacaaagggaaggtgtaaatattacagctctcagg
gaaatcaaaatgctcaaagagctcaagcatcctcatataattctgctcattgatgcattt
cctcacaaggaaaacttgcatcttgtctttgagttcatggagactgacctcgaagctgtc
atccgcgattccaacatattcctctcacccgccgacatcaaatcttacctcctaatgaca
tttaaaggacttgcttattgccacgataaatgggttttgcacagggatatgaagccaaat
aacttgttaataggagttgatggacaactgaagcttgcagattttggcttagcacgtata
tttggtagtccaaatcgtaaatttacccaccaggtgtttgctagatggtacagagcacca
gaacttttgtttggtgcaaaacaatatggtgctgcagttgatgtttgggccgttggctgc
atattcgccgaacttctactacgcagaccatttcttcagggaaacagtgatattgatcaa
ttaagcaaaatatttgctgcttttgggacaccaaaagcagatcagtggccggatgtaaca
aagcttccagattatgtagagtatcaatttgtccctgcaccgtctctacgttctttattc
ccagcagttagtgaagatgctctcgacttgttgtccaaaatgtttacctatgacccaaag
gccagaatttccataaagcaggctctagaacacagatacttcacttctgcacctgctcct
actgacccggctaagctcccaaagcccgttcataagcaggatggtaaatcctcttacggt
aaacatgaggccattacagtgctatcaccaccacgtaagcttagaagagtgatgcctgag
cgtgggagggttgatagtttgaaggctcatgttgacaaggatcaacaagcacccatgtca
ttagattttaccatcctcgctgagcgacctccaaaccggccaacaatcaccagtgctgat
agatctcatctgaagaggaaactcgatcttgagttccaataa

DBGET integrated database retrieval system