KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_472450Help
Entry
ARALYDRAFT_472450 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00010  Glycolysis / Gluconeogenesis
aly00260  Glycine, serine and threonine metabolism
aly01100  Metabolic pathways
aly01110  Biosynthesis of secondary metabolites
aly01200  Carbon metabolism
aly01230  Biosynthesis of amino acids
Module
aly_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
aly_M00002  Glycolysis, core module involving three-carbon compounds
aly_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ARALYDRAFT_472450
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ARALYDRAFT_472450
Enzymes [BR:aly01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ARALYDRAFT_472450
Membrane trafficking [BR:aly04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    ARALYDRAFT_472450
Exosome [BR:aly04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ARALYDRAFT_472450
  Exosomal proteins of melanoma cells
   ARALYDRAFT_472450
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 9326559
NCBI-ProteinID: XP_002890497
UniProt: D7KLN5
Position
Unknown
AA seq 329 aa AA seqDB search
MATATFHQSIVSFASPSSTISQCGFKIDSSLSFTSKKINFCKIKAMASVSYNNTLLSPSK
TIPDNSLKKSNEAALILIRHGESLWNEKNLFTGCVDVPLTEKGVEEAIEAGKRISNIPVD
VIFTSSLIRAQMTAMLAMIQHRRKKVPIILHDESEQAKTWSQVFSDETKNQSIPVIPAWQ
LNERMYGELQGLNKQETAERYGKQQVHEWRRSYDIPPPKGESLEMCAERAVAYFQDNIEP
KLAAGKNVMIAAHGNSLRSIIMYLDKLTCQEVISLELSTGIPLLYIFKEGKFMKRGSPVG
PTEAGVYAYTKRLAQYRQKLEEDSEVICS
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggctacggctacgtttcaccaatcaatcgtttcatttgcttctccttcttccacaatc
tctcaatgtggattcaagatcgattcttcactgagttttacctcaaaaaagataaacttt
tgcaagattaaagcaatggcatcagtttcttataacaacactctcttgtctccttccaag
accatccctgacaattctctaaagaaatcaaatgaagcagctttgatattgattaggcat
ggagaatctttgtggaacgagaagaatctttttacgggctgtgttgatgtgccattgact
gagaaaggtgttgaagaagctattgaagcagggaagaggattagtaacatacctgttgat
gttatctttacatcgtctttgattcgtgctcagatgactgcaatgcttgctatgattcaa
caccgtcgtaagaaggttccgattatcttgcacgatgaaagcgaacaggcgaaaacttgg
agtcaagttttcagtgatgagactaaaaaccaatccattcctgtcatacccgcttggcag
cttaatgaaagaatgtatggagaattgcaaggtcttaacaagcaagaaacagcggaaaga
tacgggaaacagcaagttcacgaatggcgtaggagttatgatattcctcctcccaaaggc
gagagtttggagatgtgtgctgagagagcagtggcttattttcaggacaatatcgaacca
aagcttgcagctggaaagaacgtaatgatagctgctcacgggaactcgctgcggtctatc
ataatgtatcttgacaaattgacttgccaggaggtgataagtctagagctatcgaccgga
atacctcttctctacatattcaaagaaggcaaattcatgaagcggggaagcccggttggt
ccaacagaagccggtgtctatgcttataccaagagattggctcaatacagacagaagcta
gaggaagacagtgaagtaatctgttcctga

DBGET integrated database retrieval system