KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_472589Help
Entry
ARALYDRAFT_472589 CDS       T01578                                 

Gene name
GGT1
Definition
alanine-2-oxoglutarate aminotransferase 1
Orthology
K14272  
glutamate--glyoxylate aminotransferase [EC:2.6.1.4 2.6.1.2 2.6.1.44 2.6.1.-]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Alanine, aspartate and glutamate metabolism
Glycine, serine and threonine metabolism
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
C4-dicarboxylic acid cycle, NAD - malic enzyme type
Photorespiration
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ARALYDRAFT_472589 (GGT1)
   01210 2-Oxocarboxylic acid metabolism
    ARALYDRAFT_472589 (GGT1)
   01230 Biosynthesis of amino acids
    ARALYDRAFT_472589 (GGT1)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ARALYDRAFT_472589 (GGT1)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    ARALYDRAFT_472589 (GGT1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ARALYDRAFT_472589 (GGT1)
   00260 Glycine, serine and threonine metabolism
    ARALYDRAFT_472589 (GGT1)
Enzymes [BR:aly01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     ARALYDRAFT_472589 (GGT1)
    2.6.1.4  glycine transaminase
     ARALYDRAFT_472589 (GGT1)
    2.6.1.44  alanine---glyoxylate transaminase
     ARALYDRAFT_472589 (GGT1)
    2.6.1.-  
     ARALYDRAFT_472589 (GGT1)
Amino acid related enzymes [BR:aly01007]
 Aminotransferase (transaminase)
  Class I
   ARALYDRAFT_472589 (GGT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 481 aa AA seqDB search
MALKALDYDTLNENVKKCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
QVVALCQAPFLLDDPNVGMLFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFI
QRRDGYPSDPELIFLTDGASKGVMQILNCVIRGDGDGILVPVPQYPLYSATISLLGGTLV
PYYLDESQNWGLDVNNLRQSVAQARSQGITVRAMVIINPGNPTGQCLSEANIREILKFCY
NEKLVLLGDEVYQQNIYQDERPFISSKKVLMEMGSPFSKGVQLVSFHTVSKGYWGECGQR
GGYFEMTNLPPRVVEEIYKVASIALSPNVSAQILMGLMVSPPKPGDISYDQFARESKGIL
ESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPGAIQAAKQAGKVPDVFYCLKL
LEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMTQYDNNVGYSR
M
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggctctcaaggcattagactatgatactctgaatgaaaacgtcaagaagtgtcaatac
gccgtcagaggtgaactctatctccgagcttctgagcttcagaaagaaggcaaaaagatt
atcttcacaaacgttgggaaccctcatgctttaggacagaagccgttgacatttcctcgt
caggtggttgcgctttgtcaagctccgtttctactagatgacccaaatgttggaatgctg
tttccagctgatgctattgcaagagctaaacattatctttccttgacttcaggcggttta
ggtgcttacagtgactccagaggccttccaggagttaggaaagaggttgctgagttcatt
caacgacgtgatgggtatccaagtgatccagaactcatctttctcactgatggagctagc
aaaggtgtgatgcaaatcttgaattgtgttatacgcggtgatggagacgggattctagtt
ccggttccacagtatccactctactcagctaccatatcactgttaggtggtactcttgtt
ccttactatcttgatgagtctcaaaactggggacttgatgttaataaccttcgacaatcc
gttgctcaggctcgttctcaagggataactgtaagggcaatggtgatcattaaccctggg
aacccaactggtcagtgtctaagcgaagctaacataagagagatattgaagttctgttat
aacgagaaattggttcttctgggagacgaggtttatcagcagaacatataccaggatgag
cgtccctttatcagctccaagaaggttttgatggaaatgggttcaccgttcagcaaggga
gttcagcttgtatcttttcacacagtctcgaaaggatattggggcgaatgtggacagcga
ggtggatactttgagatgaccaacctccctccaagggttgttgaggagatatacaaggtt
gcatcaattgccctcagccccaatgtctctgcgcagatcttaatgggtttgatggttagt
cctccaaagcctggagatatttcatatgatcagttcgcccgtgaaagcaaggggattctt
gaatctttgagaagaagagcaaggatcatgactgatggattcaacagctgcaaaaacgtc
gtgtgcaatttcacagaaggtgcaatgtattcgtttcctcaaatacggttaccaccggga
gctatccaagctgcaaaacaagctggaaaagtgccagacgttttctactgtctgaagctc
ttagaagccacaggaatctccacagtccctggctctggatttggacagaaagaaggcgtg
ttccatctgaggacaacgatcctgccagcggaagaagagatgccggagatcatggatagc
ttcaagaagttcaacgacgagttcatgactcagtacgataataacgttggttattcgaga
atgtga

DBGET integrated database retrieval system