KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_473164Help
Entry
ARALYDRAFT_473164 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:aly00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    ARALYDRAFT_473164
Translation factors [BR:aly03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    ARALYDRAFT_473164
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 243 aa AA seqDB search
MVVVDSSVSAIMADQNIDPNTATNPSRQEKHVPAIKAISGDEKSPSKEKKNDAYASKKST
TVIQKSHCFQNSWTFWFDNPSSKSNQVTWGSSLRSLYTFATIEEFWSLYNNIHPPTKWVP
GADLYCFKHKIEPKWEDPICGNGGKWTMFFPKAATLESNWLNTLLALVGEQFDQGDEICG
AVLNFRARGDRISLWTKNAANEEAQLSIGKQWKELLGYNDTIGFIVHEDAKTLDRDAKRR
YTV
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggtggttgttgattcttcggtatcggcgataatggctgatcagaacatcgatcctaac
accgcgacgaaccctagccgtcaagagaagcatgttccggcgattaaggctatctccggt
gacgagaaatctccgtcgaaggagaaaaagaacgatgcctacgcgtcgaagaaatcaacc
accgtaatccagaaatcgcactgcttccagaattcttggaccttttggttcgataatcct
tcctcgaaatcgaatcaagtcacatggggaagttctttgagatctttgtacacattcgct
actatcgaagagttctggagtctatacaataacattcatcctccaaccaagtgggttcca
ggggcggatctctactgcttcaaacataagattgaaccaaaatgggaagatccgatctgt
ggtaatggaggaaaatggactatgtttttccctaaagcagctacactagaatccaattgg
cttaacacgctacttgcgttggttggtgagcaatttgaccaaggagatgagatttgtggg
gcagttttgaacttcagagccagaggggacaggatctctctatggacaaagaacgctgca
aatgaggaggctcagctaagcattgggaagcagtggaaggaacttcttggctacaatgac
acaatcggatttatagttcatgaggatgcaaagactcttgatcgtgatgctaaacgtcga
tatactgtatga

DBGET integrated database retrieval system