KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_473468Help
Entry
ARALYDRAFT_473468 CDS       T01578                                 

Definition
ubiquitin carboxyl-terminal hydrolase family protein
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 894 aa AA seqDB search
MTIPDSESTGVCEVPYSPEEERRIVTELNNEAEADLKEGNLYFVISNRWYTRWQRFVGLL
TEETSEVTRPGPIDNHDIIDSESDASDPQLRIMLEEGVDYTLVPQQVWRKLVEWYKGGPP
LPRKLISQGFYTKSFSVEVYPLCLKLTDSRDESTTIIRLSKQASIGQLYEMVCAGRGVAK
EKARIWDYFEKKKSVLLDPSSEKSVEESGLQLNQDILLDVDGSASSQYDMSLAGNELALV
PLEPTRSDAMDIVRGGGNLSNGHSNGSKFSLFGRNAFEDDVSSSTFGKGERRGLGGLQNL
GNTCFMNSTLQCLAHTPPIVEYFLQDYSSDINAENPLGMRGELAIAFGELLRKLWSSGQN
AVAPRAFKTKLARFAPQFSGYNQHDSQEMLAFLLDGLHEDLNKVKRKPYIEAKDSDGRPD
DEVAEEKWKYHKARNDSVIVDVCQGQYKSTLVCPDCGKISITFDPFMYLSLPLPSSRTRS
MTVTVFYGDGSHLPMPYTVTVPKDGSCRDLSNALGTACCLNNDESLLLAEVYDHKVFKYF
ENPLELLNGIKDNERIVAYRFNQMHKGLGKVKLEILHGEQEKYDSGRGPKLFGTPLVTYI
NKEPLTGSDIAASIFGLLSPLRRVHMSSIVHSENENSHVPDVADESSRSASSRDTETEDN
AVDDRELSFSLLPDYHSFSLQLLDSDSVVNPGSVTKVLVKWNEKEHEKYDSSYLNDLPEV
HKTSFLAKKIRQEEISLFSCLEAFLAEEPLGPDDMWYCPGCKEHRQANKKLDLWKLPDIL
VFHLKRFTYSRYFKNKIDTLVNFPIHGLDLSKYVTNKDGQSYLYELYAISNHYGGLGGGH
YTAYAKLMDENKWYDFDDSRVSAVNEYEIKTPAAYVLFYQRVKSESETSDMKMD
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atgacaatccctgattctgaatccaccggagtttgtgaagttccttattctcctgaggaa
gagagacgtattgtgacagagcttaataacgaagcggaggctgatttgaaagagggaaac
ttgtatttcgttatctcaaataggtggtatacaaggtggcagagatttgttggcctacta
acagaagagacttcagaagttaccaggcctggtccaattgataatcatgatataattgat
agtgaaagtgatgctagtgatccgcagcttcgtatcatgctggaggaaggcgtcgactat
actctagttcctcaacaagtttggagaaaactcgttgaatggtataaaggaggtcctcca
ttaccaaggaagttgatctctcaaggattttacactaagagctttagtgtggaggtttac
ccactctgtcttaagttgacagatagtagagacgaaagcactaccatcataaggttgagc
aaacaggcttctataggtcaactttatgagatggtttgtgctggaagaggggtagcaaaa
gaaaaggctcgcatctgggattactttgagaagaagaaaagtgtactcttggatccttca
tctgaaaaaagcgtggaggaatcaggccttcaactaaaccaggatattcttcttgatgtt
gatggttctgcatcttctcaatatgacatgagcttggccggaaatgaattagctctggta
cctctagagcctacgaggtcagatgctatggatattgtgcgtggtggggggaacttatct
aatggtcactccaacggttccaagtttagcctctttgggagaaacgctttcgaagatgat
gtttcttcaagtacttttgggaaaggagagaggagaggtttaggaggattgcagaatttg
ggaaatacatgcttcatgaatagtactcttcagtgtttggcccatactccccctattgtt
gaatattttctacaagattacagctccgacataaatgcagagaatcctttgggaatgcgt
ggtgagcttgcaattgcatttggtgagctgttgaggaaattgtggtcatctggacagaat
gcagttgctccacgtgcttttaagacaaaattggctcgatttgctccacaatttagtggt
tataatcagcatgattctcaagaaatgcttgctttcttattggatgggctccatgaagac
ttgaacaaggtaaaacgaaaaccttatattgaagctaaagattcagatggtcgtccagat
gatgaagtagctgaagaaaagtggaaataccacaaggcccgaaatgactcagtgatagtt
gacgtctgccaaggacaatacaagtcaacactggtctgcccagattgtggaaaaatctcg
atcacctttgatcccttcatgtacttatctttgccgttgccatcgagtcgcactcgatca
atgactgttacagtgttttatggcgatggaagccatcttccgatgccatacactgtaaca
gttcctaaagatggttcttgtagagacctcagtaatgcattaggcactgcttgctgctta
aacaatgacgaaagccttttactcgcagaggtatatgaccacaaggtctttaaatatttt
gagaatcccctggagttgttgaatgggataaaagacaatgaacgtattgtggcatatcgg
ttcaaccagatgcacaaaggtttaggaaaagtcaaacttgaaattcttcatggggagcag
gaaaagtatgatagtggcagaggcccaaagctttttggaactccccttgtcacttatatc
aacaaagaaccacttactggatctgacattgctgcaagcatcttcggattgctgtcacct
ctacgccgggttcatatgtcatccatagttcatagtgaaaacgagaatagccacgttcca
gatgttgcagatgaatcatccagaagtgcatcatctagagacactgaaacagaagataat
gcagttgatgatagagaattatctttcagcctcttgccagattaccattctttcagtctc
cagctacttgattccgattctgttgtgaatcctggtagtgttacaaaggttctagtcaag
tggaatgagaaagagcatgagaaatatgactccagctacttgaatgatctacctgaggtt
cataaaacaagtttcttggcaaagaagataaggcaagaggaaatatctttgttttcgtgc
ttggaagcttttctagcggaagagcctttaggaccagatgatatgtggtattgtcctggt
tgcaaagaacatagacaagcgaataagaagctagacttgtggaagttgccagatattctt
gtgttccacttgaaacggttcacgtatagcagatatttcaagaataagattgatacatta
gtgaatttcccgattcatggtctagatttaagcaagtatgtaacgaacaaagacggtcag
tcatatctttacgagctgtatgccattagcaatcattatggtggcctgggaggtggtcac
tacactgcttacgctaagttgatggatgagaacaaatggtatgattttgatgacagccgt
gtttcagctgtaaatgaatacgagatcaagactccggctgcttacgttttgttctatcaa
agagtgaaaagtgaatcagagacatcggatatgaaaatggattag

DBGET integrated database retrieval system