KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_473597Help
Entry
ARALYDRAFT_473597 CDS       T01578                                 

Definition
(RefSeq) EMB3003
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00010  Glycolysis / Gluconeogenesis
aly00020  Citrate cycle (TCA cycle)
aly00620  Pyruvate metabolism
aly01100  Metabolic pathways
aly01110  Biosynthesis of secondary metabolites
aly01200  Carbon metabolism
Module
aly_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ARALYDRAFT_473597
   00020 Citrate cycle (TCA cycle)
    ARALYDRAFT_473597
   00620 Pyruvate metabolism
    ARALYDRAFT_473597
Enzymes [BR:aly01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ARALYDRAFT_473597
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase
Motif
Other DBs
NCBI-GeneID: 9327165
NCBI-ProteinID: XP_002893823
UniProt: D7KK66
Position
Unknown
AA seq 461 aa AA seqDB search
MSRLLQTPFLPSVTLPTKTRSSVTGFRVKPRIIPIQAKIREIFMPALSSTMTEGKIVSWV
KSEGDKLNKGESVVVVESDKADMDVETFYDGYLAAIMVEEGGVAPVGSAIALLAETEDEI
ADAKAKASGSGGGGDSQAPPTAAIEAPVAVEKKIAAAPVAVKAVAASAVHPASEGGKRIV
ASPYAKKLAKELKVELAGLVGSGPMGRIVAKDVEAVAAGGGVQAAVAVKEVVAAPSVELG
SVVPFTTMQGAVSRNMVESLTVPTFRVGYTITTDALDALYKKIKSKGVTMTALLAKATAL
ALAKHPVVNSSCRDGNSFVYNSSINVAVAVAIDGGLITPVLQNADKVDIYSLSRKWKELV
DKARAKQLQPQEYNTGTFTLSNLGMFGVDRFDAILPPGTGAIMAVGASQPSVVATKDGRI
GMKNQMQVNVTADHRVIYGADLAQFLQTLASIIEDPKDLTF
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgtcttctccaaacacccttcttaccttccgttactctccccacaaaaacacga
tcttccgttacgggtttccgtgtaaagcccagaatcatcccaattcaagcaaagatccga
gaaatcttcatgcctgcactaagttctacaatgaccgaaggcaaaatcgtctcttgggtt
aaatcagaaggcgataaactcaacaaaggagagagtgttgttgttgttgaatctgataaa
gctgatatggatgttgagactttctacgatggttatttagctgcgattatggttgaagaa
ggtggtgttgctcctgttggttctgctattgctttgttagctgagactgaggatgagatt
gctgatgctaaggctaaagcttctggtagtggtggtggtggtgattctcaggctcctcct
acggctgcaattgaagcacctgtggctgttgagaagaagattgcggctgctccggttgcg
gttaaggcggttgctgcgtctgcggtgcatccggcgtctgaaggagggaagaggattgtg
gcgtctccttatgctaagaagttagctaaggaattgaaagtggagttggctggtttagtt
ggaagtggaccgatgggaaggattgtggctaaagatgttgaggcggttgctgctggagga
ggagttcaagctgcggtagctgttaaggaggtagtggcagctcctagtgtggagttgggg
tcggtggttccgtttacgacaatgcagggggctgtgagcaggaatatggtggagagtttg
acggttcctacttttagagtcggttacacgattactacggatgctcttgatgctctctac
aagaagattaagtcaaaaggtgtgacaatgacagcactcctagcaaaggcaactgcactt
gcactggcgaaacatccagttgtaaactcttcctgtagagatggtaacagttttgtgtat
aacagtagcatcaacgttgctgttgctgttgctattgatggtggtttgatcactccggtg
cttcagaacgctgataaggttgacatttattcgttgtctagaaaatggaaagaattggtt
gataaggctcgagccaagcagctgcagcctcaggagtacaacactggtaccttcactctc
tctaacctaggaatgtttggcgttgatcggtttgatgctattctaccccctggaacagga
gcgattatggctgtaggagcatctcaaccttcagtggttgctactaaagacggccgcatt
ggcatgaaaaaccagatgcaggtgaatgtgacggcagatcatcgtgtcatctatggtgct
gatctcgcacagttcttgcaaacattggcaagcattattgaggacccaaaggaccttaca
ttctag

DBGET integrated database retrieval system