KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_473714Help
Entry
ARALYDRAFT_473714 CDS       T01578                                 

Definition
acetyl-CoA carboxylase 2
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:aly01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:aly00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:aly00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:aly00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 2364 aa AA seqDB search
MEMRALVSSCATGNGGSDPFSFTKVSPWITTVGGKDRDFPTTVKLRTSMRTFKGVSIRGR
TFKGVSTRVLSRNKQQFPLFCFLNPDPTSFRDNDISEAQRTVVLPGGSVNGYHQSEVVPG
RNDGTVAEVDEFCKALGGKRPIHSILVATNGMAAVKFIRSIRTWAYETFGTEKAVKLVAM
ATPEDMRINAEHIRIADQFVEVPGGTNNNNYANVQLIVEMAEVTRVDAVWPGWGHASENP
ELPDALKAKGIIFLGPPAASMIALGDKIGSSLIAQAADVPTLPWSGSHVKIPPGSSLVTV
PEEIYKKACVYTTEEAIASCQVVGYPAMIKASWGGGGKGIRKVHNDDEVKCLFKQVQGEV
PGSPIFIMKVASQSRHLEVQLLCDQNGNVAALHSRDCSVQRRHQKIIEEGPITVAPQETV
KKLEQAARRLAKSVNYVGAATVEYLYSMDTGEYYFLELNPRLQVEHPVTEWIAKVNLPAA
QVSVGMGIPLWQIPEIRRFYGMEHGGGYDSWRKTSVVASPFDFDEAESIRPKGHCVAVRV
TSEDPDDGFKPTSGKIQELSFKSKPNVWAYFSVKSGGGIHEFSDSQFGHVFAFGESRAMA
IANMVLALKEIQIRGEIRTNVDYTIDLLHASDYRENKIHTGWLDSRIAMRVRAERPPWYL
SVIGGALYKASTTSSAVVSDYVGYLEKGQIPPKHISLVHSQVSLNIEGSKYTIDVVRGAS
GTYRLRMNNSEVVAEIHTLRDGVNQDIHASRILDGKSHVIYAEEEAAGTRLLIDGKTCLL
QNDHDPSNLIADTPCKLLRYLVSDNSSIDADMPYAEVEVMKMCMPLLSPASGVIHFKMSE
GQTIEAGELIAKLDLDDPSAVRKAKLFRGSFPRLGLPTAISSKVHQRCAATLNDARMILA
GYEHKVDEVVQDLLNCLDSPELPFLQWQECFVALATRLPKNLRNMLESKYKEFEIIFKNS
LTTDFPAELLKGILVAHLSSCDEKERGAVERLIEPLMSLVKSYEGGRESHARLIVHSLFE
EYLSVEELFNDNMLADVIERMRQQYKKDLLKIVDIVLSHQGIKNKNKLVLRLMEQFVYPI
PAAYRDKLIRFSTLNHTNYSELALKASQLLEQAKLSELRSNIARSLSELEMFSEDGEDMD
TPKRKSAINERMEDLVSASVAVEDALVGLFDHSNHTLQRRVVETYIHRLYQPYVVKESVR
MQWHRSGLIASWEFLEEHFERKNIGSDDHETSEKGIVEKRSKRKRGAMVIIKSLQLLPSI
ISAALRETNHNDYEYAGAPLSGNIMHIAIVGNNNQMSLLQDSGDEDQTQERVNKLAKILK
EEEVSSSLCSAGVGMISCIIQRDEGRTPMRHSFHWSMEKQYYVEEPLLRHLEPPLSIYLE
LDKLKGYSNIQYTPSRDRQWHMYTVTDKPVPIKRMFLRSLVRQAAMNDGFMLQQGRDYQL
SQTLLSMAFTSKYVLRSLMNAMVELELNAHNVAMKPDHAHMFLCILPEQQIEDLVPYPRR
VEVNAEDEETTVEMILEEATREIHRSVGVRMHGLGVCEWEVRLWLVSSGLANGAWRVVVA
NVTGHTCTVHIYREVEATGRNSLIYHSITKKGPLHGTPINGQYKSLNNLDRKRLAARRSN
TTYCYDFPLAFETALELLWASQHPGVRKPCKNTLINVKELVFSNTEGSSGTSLIPVERPA
GLNDIGMVAWILEMSTPEFPMGRKLLIVANDVTFKAGSFGPREDAFFLAVTELACTKKLP
LIYLAANSGARLGVAEEVKACFKVGWSDEVSPENGFQYIYLSSEDYARIGSSVIAHEVKL
PSGETRWVIDTIVGKEDGIGVENLTGSGAIAGAYSRAYNETFTLTFVSGRSVGIGAYLAR
LGMRCIQRLDQPIILTGFSTLNKLLGREVYSSHMQLGGPKIMGTNGVVHLTVSDDLEGVS
AILNWLSYIPAYVGGPLPVLAPLDPPERTVEYIPENSCDPRAAIAGINDNTGKWLGGIFD
KNSFVETLEGWARTVVTGRAKLGGIPVGVVAVETQTVMQIIPADPGQLDSHERVVPQAGQ
VWYPDSAAKTAQALMDFNREQLPLFILANWRGFSGGQRDLFEGILQAGSTIVENLRTYRQ
PVFVYIPMMGELRGGAWVVVDSQINSDYVEMYADETACGNVLEPEGMIEIKFRRKELIEC
MGRLDKTLINLKANIQDAKQNEAYANIELLQKQIKTREKQLLPIYIQIATKFAELHDTSM
RMAAKGVIKSVVEWSGSRSFFYKKLYRRIAESSLVRNIRKASGDILSYKSAMGLIQDWFS
KSEIAKGKEEAWTDDKLFFTWKDNVSNYEQKLCELRAQKLLNQIAEIGNSSDLQALPQGL
ANLLNKVELSRREELVDAIRKVLN
NT seq 7095 nt NT seq  +upstreamnt  +downstreamnt
atggagatgagagctttggtttcttcgtgtgctaccggtaatggaggttctgatccgttt
agcttcacgaaagtttctccatggatcacaacagttggtggtaaggacagagattttcca
acgacagtgaagctaagaactagtatgagaacctttaaaggagtttctataagagggaga
acctttaaaggagtttcgacaagagttttgtctcggaacaaacaacagtttcctctgttt
tgtttcctaaaccctgatccgacctccttccgggataatgatatatctgaagctcaaagg
acagtggttttaccgggtggctcggttaatgggtatcatcaaagtgaagtagtacccggt
agaaatgatgggacggtggctgaagtcgatgagttctgtaaagctcttggagggaaaagg
ccaatccatagtattttggttgctactaatggaatggcagctgtgaagtttatacgtagt
atcagaacatgggcttacgaaacatttggcacggaaaaagctgtaaagttggtggcgatg
gcgactcctgaagatatgcggatcaatgcggaacatatcagaattgctgatcagtttgtt
gaggttccgggaggaactaacaataacaattatgctaatgttcagcttattgtggagatg
gccgaggtaactcgtgtggatgcagtttggcctggttggggtcatgcatctgaaaaccct
gaattacctgatgctttaaaggcgaaaggaatcatatttcttggtcctcctgcagcttca
atgatagcattaggggataagattggttcgtcgttgattgcacaagctgctgatgtacct
actctgccatggagtggttcccatgttaaaatacctccgggtagcagcttggtaacggta
cccgaggaaatctacaagaaagcttgtgtgtacacaactgaagaagcaattgctagttgt
caagttgttggttacccagcaatgatcaaagcatcctggggtggtggcggtaaaggcatt
aggaaggttcataatgatgatgaggttaagtgtctattcaagcaagttcaaggtgaggtc
cctggctcgccgatattcataatgaaggttgcttcacagagtcggcatttggaggtgcag
ctgctgtgtgaccaaaatggaaacgtagcagcattgcacagccgtgattgcagcgtccag
agaagacatcaaaagatcatagaggaaggtcccatcactgtcgctccgcaagaaaccgta
aagaaacttgagcaagcagctagaaggttagctaagagtgttaactatgttggagctgct
accgttgagtatctctatagtatggacactggggaatactacttcttagagcttaaccct
cgtttacaggttgagcatcctgtaactgagtggattgccaaggtaaatcttcctgctgct
caagtttctgtcgggatgggaattcctctctggcaaatccctgagataagacggttctat
ggcatggaacatggtggaggttatgattcttggaggaaaacatctgttgtagcctcccct
tttgattttgatgaagctgaatctataaggccaaaaggtcattgtgtcgctgtacgtgtg
acaagcgaggatcctgatgacgggtttaaaccaaccagcggtaaaatacaggagttgagt
tttaagagcaagccaaatgtgtgggcgtacttctctgtcaagtctggtggaggcatccat
gagttctcagattcccagtttggacatgtttttgcatttggggaatccagagccatggca
atagcaaacatggttcttgcgctgaaagaaattcaaattcgtggagaaatcaggactaat
gttgactacacgatcgaccttctacatgcttctgattaccgggaaaacaaaatacacact
ggttggttggacagtaggattgctatgcgggttagagcagaaagacctccatggtatctc
tctgtgatcggtggggctctatataaagcatcaacgaccagttctgctgtagtttcggat
tacgttggttatctagaaaaggggcaaattcccccaaagcatatatctcttgtgcattct
caagtgtcactgaatattgaagggagtaaatatacgattgatgtagtccggggtgcatca
ggaacttacaggctaagaatgaacaactcagaagttgtagcagaaatacacactctacgt
gatggagttaaccaagacatacatgcgtcacgcatattggatggtaaaagccatgtgata
tatgcagaggaagaagcggcaggaactcgtcttctcattgatggaaaaacttgtttacta
cagaatgatcacgatccttcaaatttgattgctgatacaccatgcaagttattgaggtac
ctggtttcagacaacagcagtattgatgctgatatgccctacgcagaagttgaagtcatg
aagatgtgcatgccacttctttcacctgcgtcaggagttatccatttcaaaatgtctgaa
ggacaaaccatagaggctggtgaactcatagccaagcttgatcttgatgatccttctgct
gtcagaaaggccaaactcttccgtggaagtttcccacgattagggcttccaacggcaatc
tccagtaaagttcatcagagatgtgctgcaactttaaatgatgctcgcatgattcttgcc
ggctatgagcataaagtagatgaggttgttcaagacttacttaattgtcttgatagccct
gaactgccatttcttcagtggcaagagtgctttgtagccctggcgacacgattaccgaaa
aatctcaggaacatgctagaatcaaagtacaaggaatttgagattatcttcaaaaactcc
cttaccacagatttccctgccgaactcttaaagggcatccttgtggctcatttatcatct
tgtgatgagaaagagagaggtgccgttgaacggctcattgaaccattgatgagccttgtg
aagtcttatgaaggtggtagagaaagtcatgcccgtcttattgttcattccctctttgaa
gaatatctgtcagtagaagaattattcaatgataacatgctggctgatgtaatagaacgc
atgcgtcagcaatacaagaaagatctattaaagattgtcgatatcgtgctttcacaccag
ggtataaaaaacaaaaacaaacttgttctacgactcatggagcagttcgtttaccctatt
cctgctgcatacagagataaacttatccgattctcaacacttaaccatactaattactct
gagttggcactcaaggcgagtcaattgctcgaacaggccaaactaagtgaacttcgttca
aatattgctagaagcctttcagaattagaaatgttttcagaagatggagaagatatggat
actcccaagaggaagagtgccattaatgaaaggatggaagatcttgtgagcgcatctgta
gctgttgaagacgctctcgtgggattatttgaccacagcaatcacacgcttcaaagacgg
gttgttgagacttatattcacagattataccagccttatgtcgttaaagaaagtgtgagg
atgcagtggcaccgttctggtcttattgcttcttgggagttcctagaggagcattttgaa
agaaaaaacattggctcagatgatcacgagacatctgaaaaaggaattgttgagaagcgt
agtaagagaaaacggggggctatggttataatcaaatcgctgcagttgctgccgagtata
ataagtgcagcattgagagaaacaaaccacaacgactatgaatatgccggagctccttta
tctggcaatatcatgcacattgctattgtgggcaacaacaatcagatgagtctgcttcag
gacagcggggatgaggaccaaactcaggaaagagtaaacaagctggccaaaatacttaaa
gaggaagaagtgagttcaagcctctgttctgccggtgttggtatgatcagttgtataatt
cagcgagatgaaggacgaacaccaatgagacattctttccattggtcgatggagaaacag
tattacgtagaagagccgttgctgcgacatcttgaacctcctctatccatataccttgag
ttggataaattgaaaggttactcaaatatacagtatacgccttcacgagaccgtcaatgg
catatgtatactgttacagacaagccagtgccaatcaaaaggatgttccttagatctctt
gttcgacaagctgcaatgaatgatgggtttatgttgcagcaagggcgggactaccaactt
agccaaacactgctctccatggcgtttacgtcaaaatacgttctgaggtctttgatgaat
gccatggtggaacttgaactgaatgcacataatgttgccatgaaaccagaccacgcacat
atgttcttatgcatactacctgagcagcagatagaagatcttgtgccttaccccaggaga
gttgaagtgaatgcggaggatgaagaaacaacagttgagatgatcttagaagaagcaaca
cgagagatacataggtctgttggagtgagaatgcatggattgggtgtttgcgaatgggaa
gtgcgactgtggttggtgtcctcgggactggcaaatggcgcttggagggtcgtggttgca
aacgtgacaggccatacatgcactgtccatatataccgagaagtggaagctactggaaga
aacagtttaatctaccactcaataactaagaagggacctttgcatggaactccaatcaat
ggtcaatataaatcactgaataatctggacaggaaacgtctagccgcaaggaggagtaac
actacttattgctatgacttccccttggcatttgagacagcattggagctcctgtgggca
tcacaacacccgggagttcggaaaccatgcaagaatacactcatcaacgtcaaagagctt
gtattctccaatacagaaggttcttcgggtacatctcttattccggttgaacgaccagct
ggtctcaacgacattggaatggtggcctggatcttagagatgtcaactcctgagtttcct
atgggacggaaacttctcattgtcgccaatgatgtcacattcaaagctggttcttttggt
cctagagaggatgcatttttccttgctgtgactgaactcgcttgtaccaaaaagcttccc
ttgatttacttggcagcaaattctggtgcccgactcggtgtagctgaagaagtaaaagcc
tgcttcaaagttgggtggtcggatgaagtttcccccgagaatggttttcagtatatatac
ctaagctctgaagactatgcaaggattggatcatctgtcattgcccacgaagtgaagctc
cctagtggcgaaacaaggtgggtgattgatacaattgttggtaaagaagatggtattgga
gttgagaatttaacaggaagtggggcaatagcgggtgcttactcaagggcgtacaatgaa
acttttacgctaacctttgttagtggaagatcggtcggaatcggtgcttaccttgcccgc
ctgggcatgaggtgcatacagagactagaccagccaatcatcttgactggcttttctacg
ctcaacaagctgcttgggcgtgaggtctatagctctcacatgcaacttggaggcccaaaa
atcatgggcacaaatggtgttgttcatcttacagtctcagatgatcttgagggcgtatca
gcaattctcaactggctgagctacattcctgcttacgtgggtggtcctcttcctgttctt
gctcctttagatccaccggagagaactgtggagtatatcccagagaactcttgtgaccca
cgagctgctatagctgggattaatgacaatactggtaaatggcttggtggtatctttgat
aaaaatagctttgttgagactcttgaaggctgggcaaggacggtagtgactggtagagct
aagcttgggggaatacccgttggagttgttgctgtcgagacacaaactgtaatgcagatc
atcccagcagatcctggacagcttgactctcatgaaagagtggttccacaagcaggacaa
gtctggtatcctgattcagcagccaaaacagctcaagcgctcatggatttcaaccgggaa
cagctcccattgtttatcctagcaaactggagaggtttttcaggtgggcagagagatctt
ttcgaaggaatacttcaggcgggttcaactatagtagaaaatctgagaacctatcggcag
ccagtgtttgtgtacatcccaatgatgggagaactgcgaggtggagcgtgggtggttgtt
gatagccagataaattcggattatgttgaaatgtatgctgatgaaaccgcttgtggaaat
gtgcttgagcctgaagggatgatagagataaaatttagaaggaaagagctgatagagtgc
atgggaaggttggacaagacgctcatcaatctgaaagcaaatatccaagatgccaagcaa
aacgaggcttatgcaaacatcgagcttctccagaaacagattaaaacccgagagaagcaa
cttttaccaatttatatccaaatcgctaccaaatttgctgaactccatgacacttccatg
agaatggctgcaaaaggagtgatcaaaagtgttgtggaatggagtggctcgcggtcattc
ttctataaaaagctctatcgtagaattgcagagagctctcttgtgaggaacataagaaaa
gcttctggagacatcttatcatataaatctgctatgggtttgattcaggattggttcagc
aaatctgagattgcaaaggggaaagaagaagcttggacagacgacaaactgttcttcaca
tggaaggacaatgttagtaactatgagcaaaagctgtgtgagttgagagcgcagaaactg
ctgaatcaaattgcagagattgggaattcgtcggatttgcaggctctgccacaaggactt
gctaatcttctaaacaaggtggagctttcaagaagagaagaactggtggatgcgattcga
aaagtgttgaattga

DBGET integrated database retrieval system