KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_473714Help
Entry
ARALYDRAFT_473714 CDS       T01578                                 

Definition
(RefSeq) acetyl-CoA carboxylase 2
  KO
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    ARALYDRAFT_473714
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ARALYDRAFT_473714
   00640 Propanoate metabolism
    ARALYDRAFT_473714
  Lipid metabolism
   00061 Fatty acid biosynthesis
    ARALYDRAFT_473714
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    ARALYDRAFT_473714
Enzymes [BR:aly01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     ARALYDRAFT_473714
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     ARALYDRAFT_473714
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 2364 aa AA seqDB search
MEMRALVSSCATGNGGSDPFSFTKVSPWITTVGGKDRDFPTTVKLRTSMRTFKGVSIRGR
TFKGVSTRVLSRNKQQFPLFCFLNPDPTSFRDNDISEAQRTVVLPGGSVNGYHQSEVVPG
RNDGTVAEVDEFCKALGGKRPIHSILVATNGMAAVKFIRSIRTWAYETFGTEKAVKLVAM
ATPEDMRINAEHIRIADQFVEVPGGTNNNNYANVQLIVEMAEVTRVDAVWPGWGHASENP
ELPDALKAKGIIFLGPPAASMIALGDKIGSSLIAQAADVPTLPWSGSHVKIPPGSSLVTV
PEEIYKKACVYTTEEAIASCQVVGYPAMIKASWGGGGKGIRKVHNDDEVKCLFKQVQGEV
PGSPIFIMKVASQSRHLEVQLLCDQNGNVAALHSRDCSVQRRHQKIIEEGPITVAPQETV
KKLEQAARRLAKSVNYVGAATVEYLYSMDTGEYYFLELNPRLQVEHPVTEWIAKVNLPAA
QVSVGMGIPLWQIPEIRRFYGMEHGGGYDSWRKTSVVASPFDFDEAESIRPKGHCVAVRV
TSEDPDDGFKPTSGKIQELSFKSKPNVWAYFSVKSGGGIHEFSDSQFGHVFAFGESRAMA
IANMVLALKEIQIRGEIRTNVDYTIDLLHASDYRENKIHTGWLDSRIAMRVRAERPPWYL
SVIGGALYKASTTSSAVVSDYVGYLEKGQIPPKHISLVHSQVSLNIEGSKYTIDVVRGAS
GTYRLRMNNSEVVAEIHTLRDGVNQDIHASRILDGKSHVIYAEEEAAGTRLLIDGKTCLL
QNDHDPSNLIADTPCKLLRYLVSDNSSIDADMPYAEVEVMKMCMPLLSPASGVIHFKMSE
GQTIEAGELIAKLDLDDPSAVRKAKLFRGSFPRLGLPTAISSKVHQRCAATLNDARMILA
GYEHKVDEVVQDLLNCLDSPELPFLQWQECFVALATRLPKNLRNMLESKYKEFEIIFKNS
LTTDFPAELLKGILVAHLSSCDEKERGAVERLIEPLMSLVKSYEGGRESHARLIVHSLFE
EYLSVEELFNDNMLADVIERMRQQYKKDLLKIVDIVLSHQGIKNKNKLVLRLMEQFVYPI
PAAYRDKLIRFSTLNHTNYSELALKASQLLEQAKLSELRSNIARSLSELEMFSEDGEDMD
TPKRKSAINERMEDLVSASVAVEDALVGLFDHSNHTLQRRVVETYIHRLYQPYVVKESVR
MQWHRSGLIASWEFLEEHFERKNIGSDDHETSEKGIVEKRSKRKRGAMVIIKSLQLLPSI
ISAALRETNHNDYEYAGAPLSGNIMHIAIVGNNNQMSLLQDSGDEDQTQERVNKLAKILK
EEEVSSSLCSAGVGMISCIIQRDEGRTPMRHSFHWSMEKQYYVEEPLLRHLEPPLSIYLE
LDKLKGYSNIQYTPSRDRQWHMYTVTDKPVPIKRMFLRSLVRQAAMNDGFMLQQGRDYQL
SQTLLSMAFTSKYVLRSLMNAMVELELNAHNVAMKPDHAHMFLCILPEQQIEDLVPYPRR
VEVNAEDEETTVEMILEEATREIHRSVGVRMHGLGVCEWEVRLWLVSSGLANGAWRVVVA
NVTGHTCTVHIYREVEATGRNSLIYHSITKKGPLHGTPINGQYKSLNNLDRKRLAARRSN
TTYCYDFPLAFETALELLWASQHPGVRKPCKNTLINVKELVFSNTEGSSGTSLIPVERPA
GLNDIGMVAWILEMSTPEFPMGRKLLIVANDVTFKAGSFGPREDAFFLAVTELACTKKLP
LIYLAANSGARLGVAEEVKACFKVGWSDEVSPENGFQYIYLSSEDYARIGSSVIAHEVKL
PSGETRWVIDTIVGKEDGIGVENLTGSGAIAGAYSRAYNETFTLTFVSGRSVGIGAYLAR
LGMRCIQRLDQPIILTGFSTLNKLLGREVYSSHMQLGGPKIMGTNGVVHLTVSDDLEGVS
AILNWLSYIPAYVGGPLPVLAPLDPPERTVEYIPENSCDPRAAIAGINDNTGKWLGGIFD
KNSFVETLEGWARTVVTGRAKLGGIPVGVVAVETQTVMQIIPADPGQLDSHERVVPQAGQ
VWYPDSAAKTAQALMDFNREQLPLFILANWRGFSGGQRDLFEGILQAGSTIVENLRTYRQ
PVFVYIPMMGELRGGAWVVVDSQINSDYVEMYADETACGNVLEPEGMIEIKFRRKELIEC
MGRLDKTLINLKANIQDAKQNEAYANIELLQKQIKTREKQLLPIYIQIATKFAELHDTSM
RMAAKGVIKSVVEWSGSRSFFYKKLYRRIAESSLVRNIRKASGDILSYKSAMGLIQDWFS
KSEIAKGKEEAWTDDKLFFTWKDNVSNYEQKLCELRAQKLLNQIAEIGNSSDLQALPQGL
ANLLNKVELSRREELVDAIRKVLN
NT seq 7095 nt NT seq  +upstreamnt  +downstreamnt
atggagatgagagctttggtttcttcgtgtgctaccggtaatggaggttctgatccgttt
agcttcacgaaagtttctccatggatcacaacagttggtggtaaggacagagattttcca
acgacagtgaagctaagaactagtatgagaacctttaaaggagtttctataagagggaga
acctttaaaggagtttcgacaagagttttgtctcggaacaaacaacagtttcctctgttt
tgtttcctaaaccctgatccgacctccttccgggataatgatatatctgaagctcaaagg
acagtggttttaccgggtggctcggttaatgggtatcatcaaagtgaagtagtacccggt
agaaatgatgggacggtggctgaagtcgatgagttctgtaaagctcttggagggaaaagg
ccaatccatagtattttggttgctactaatggaatggcagctgtgaagtttatacgtagt
atcagaacatgggcttacgaaacatttggcacggaaaaagctgtaaagttggtggcgatg
gcgactcctgaagatatgcggatcaatgcggaacatatcagaattgctgatcagtttgtt
gaggttccgggaggaactaacaataacaattatgctaatgttcagcttattgtggagatg
gccgaggtaactcgtgtggatgcagtttggcctggttggggtcatgcatctgaaaaccct
gaattacctgatgctttaaaggcgaaaggaatcatatttcttggtcctcctgcagcttca
atgatagcattaggggataagattggttcgtcgttgattgcacaagctgctgatgtacct
actctgccatggagtggttcccatgttaaaatacctccgggtagcagcttggtaacggta
cccgaggaaatctacaagaaagcttgtgtgtacacaactgaagaagcaattgctagttgt
caagttgttggttacccagcaatgatcaaagcatcctggggtggtggcggtaaaggcatt
aggaaggttcataatgatgatgaggttaagtgtctattcaagcaagttcaaggtgaggtc
cctggctcgccgatattcataatgaaggttgcttcacagagtcggcatttggaggtgcag
ctgctgtgtgaccaaaatggaaacgtagcagcattgcacagccgtgattgcagcgtccag
agaagacatcaaaagatcatagaggaaggtcccatcactgtcgctccgcaagaaaccgta
aagaaacttgagcaagcagctagaaggttagctaagagtgttaactatgttggagctgct
accgttgagtatctctatagtatggacactggggaatactacttcttagagcttaaccct
cgtttacaggttgagcatcctgtaactgagtggattgccaaggtaaatcttcctgctgct
caagtttctgtcgggatgggaattcctctctggcaaatccctgagataagacggttctat
ggcatggaacatggtggaggttatgattcttggaggaaaacatctgttgtagcctcccct
tttgattttgatgaagctgaatctataaggccaaaaggtcattgtgtcgctgtacgtgtg
acaagcgaggatcctgatgacgggtttaaaccaaccagcggtaaaatacaggagttgagt
tttaagagcaagccaaatgtgtgggcgtacttctctgtcaagtctggtggaggcatccat
gagttctcagattcccagtttggacatgtttttgcatttggggaatccagagccatggca
atagcaaacatggttcttgcgctgaaagaaattcaaattcgtggagaaatcaggactaat
gttgactacacgatcgaccttctacatgcttctgattaccgggaaaacaaaatacacact
ggttggttggacagtaggattgctatgcgggttagagcagaaagacctccatggtatctc
tctgtgatcggtggggctctatataaagcatcaacgaccagttctgctgtagtttcggat
tacgttggttatctagaaaaggggcaaattcccccaaagcatatatctcttgtgcattct
caagtgtcactgaatattgaagggagtaaatatacgattgatgtagtccggggtgcatca
ggaacttacaggctaagaatgaacaactcagaagttgtagcagaaatacacactctacgt
gatggagttaaccaagacatacatgcgtcacgcatattggatggtaaaagccatgtgata
tatgcagaggaagaagcggcaggaactcgtcttctcattgatggaaaaacttgtttacta
cagaatgatcacgatccttcaaatttgattgctgatacaccatgcaagttattgaggtac
ctggtttcagacaacagcagtattgatgctgatatgccctacgcagaagttgaagtcatg
aagatgtgcatgccacttctttcacctgcgtcaggagttatccatttcaaaatgtctgaa
ggacaaaccatagaggctggtgaactcatagccaagcttgatcttgatgatccttctgct
gtcagaaaggccaaactcttccgtggaagtttcccacgattagggcttccaacggcaatc
tccagtaaagttcatcagagatgtgctgcaactttaaatgatgctcgcatgattcttgcc
ggctatgagcataaagtagatgaggttgttcaagacttacttaattgtcttgatagccct
gaactgccatttcttcagtggcaagagtgctttgtagccctggcgacacgattaccgaaa
aatctcaggaacatgctagaatcaaagtacaaggaatttgagattatcttcaaaaactcc
cttaccacagatttccctgccgaactcttaaagggcatccttgtggctcatttatcatct
tgtgatgagaaagagagaggtgccgttgaacggctcattgaaccattgatgagccttgtg
aagtcttatgaaggtggtagagaaagtcatgcccgtcttattgttcattccctctttgaa
gaatatctgtcagtagaagaattattcaatgataacatgctggctgatgtaatagaacgc
atgcgtcagcaatacaagaaagatctattaaagattgtcgatatcgtgctttcacaccag
ggtataaaaaacaaaaacaaacttgttctacgactcatggagcagttcgtttaccctatt
cctgctgcatacagagataaacttatccgattctcaacacttaaccatactaattactct
gagttggcactcaaggcgagtcaattgctcgaacaggccaaactaagtgaacttcgttca
aatattgctagaagcctttcagaattagaaatgttttcagaagatggagaagatatggat
actcccaagaggaagagtgccattaatgaaaggatggaagatcttgtgagcgcatctgta
gctgttgaagacgctctcgtgggattatttgaccacagcaatcacacgcttcaaagacgg
gttgttgagacttatattcacagattataccagccttatgtcgttaaagaaagtgtgagg
atgcagtggcaccgttctggtcttattgcttcttgggagttcctagaggagcattttgaa
agaaaaaacattggctcagatgatcacgagacatctgaaaaaggaattgttgagaagcgt
agtaagagaaaacggggggctatggttataatcaaatcgctgcagttgctgccgagtata
ataagtgcagcattgagagaaacaaaccacaacgactatgaatatgccggagctccttta
tctggcaatatcatgcacattgctattgtgggcaacaacaatcagatgagtctgcttcag
gacagcggggatgaggaccaaactcaggaaagagtaaacaagctggccaaaatacttaaa
gaggaagaagtgagttcaagcctctgttctgccggtgttggtatgatcagttgtataatt
cagcgagatgaaggacgaacaccaatgagacattctttccattggtcgatggagaaacag
tattacgtagaagagccgttgctgcgacatcttgaacctcctctatccatataccttgag
ttggataaattgaaaggttactcaaatatacagtatacgccttcacgagaccgtcaatgg
catatgtatactgttacagacaagccagtgccaatcaaaaggatgttccttagatctctt
gttcgacaagctgcaatgaatgatgggtttatgttgcagcaagggcgggactaccaactt
agccaaacactgctctccatggcgtttacgtcaaaatacgttctgaggtctttgatgaat
gccatggtggaacttgaactgaatgcacataatgttgccatgaaaccagaccacgcacat
atgttcttatgcatactacctgagcagcagatagaagatcttgtgccttaccccaggaga
gttgaagtgaatgcggaggatgaagaaacaacagttgagatgatcttagaagaagcaaca
cgagagatacataggtctgttggagtgagaatgcatggattgggtgtttgcgaatgggaa
gtgcgactgtggttggtgtcctcgggactggcaaatggcgcttggagggtcgtggttgca
aacgtgacaggccatacatgcactgtccatatataccgagaagtggaagctactggaaga
aacagtttaatctaccactcaataactaagaagggacctttgcatggaactccaatcaat
ggtcaatataaatcactgaataatctggacaggaaacgtctagccgcaaggaggagtaac
actacttattgctatgacttccccttggcatttgagacagcattggagctcctgtgggca
tcacaacacccgggagttcggaaaccatgcaagaatacactcatcaacgtcaaagagctt
gtattctccaatacagaaggttcttcgggtacatctcttattccggttgaacgaccagct
ggtctcaacgacattggaatggtggcctggatcttagagatgtcaactcctgagtttcct
atgggacggaaacttctcattgtcgccaatgatgtcacattcaaagctggttcttttggt
cctagagaggatgcatttttccttgctgtgactgaactcgcttgtaccaaaaagcttccc
ttgatttacttggcagcaaattctggtgcccgactcggtgtagctgaagaagtaaaagcc
tgcttcaaagttgggtggtcggatgaagtttcccccgagaatggttttcagtatatatac
ctaagctctgaagactatgcaaggattggatcatctgtcattgcccacgaagtgaagctc
cctagtggcgaaacaaggtgggtgattgatacaattgttggtaaagaagatggtattgga
gttgagaatttaacaggaagtggggcaatagcgggtgcttactcaagggcgtacaatgaa
acttttacgctaacctttgttagtggaagatcggtcggaatcggtgcttaccttgcccgc
ctgggcatgaggtgcatacagagactagaccagccaatcatcttgactggcttttctacg
ctcaacaagctgcttgggcgtgaggtctatagctctcacatgcaacttggaggcccaaaa
atcatgggcacaaatggtgttgttcatcttacagtctcagatgatcttgagggcgtatca
gcaattctcaactggctgagctacattcctgcttacgtgggtggtcctcttcctgttctt
gctcctttagatccaccggagagaactgtggagtatatcccagagaactcttgtgaccca
cgagctgctatagctgggattaatgacaatactggtaaatggcttggtggtatctttgat
aaaaatagctttgttgagactcttgaaggctgggcaaggacggtagtgactggtagagct
aagcttgggggaatacccgttggagttgttgctgtcgagacacaaactgtaatgcagatc
atcccagcagatcctggacagcttgactctcatgaaagagtggttccacaagcaggacaa
gtctggtatcctgattcagcagccaaaacagctcaagcgctcatggatttcaaccgggaa
cagctcccattgtttatcctagcaaactggagaggtttttcaggtgggcagagagatctt
ttcgaaggaatacttcaggcgggttcaactatagtagaaaatctgagaacctatcggcag
ccagtgtttgtgtacatcccaatgatgggagaactgcgaggtggagcgtgggtggttgtt
gatagccagataaattcggattatgttgaaatgtatgctgatgaaaccgcttgtggaaat
gtgcttgagcctgaagggatgatagagataaaatttagaaggaaagagctgatagagtgc
atgggaaggttggacaagacgctcatcaatctgaaagcaaatatccaagatgccaagcaa
aacgaggcttatgcaaacatcgagcttctccagaaacagattaaaacccgagagaagcaa
cttttaccaatttatatccaaatcgctaccaaatttgctgaactccatgacacttccatg
agaatggctgcaaaaggagtgatcaaaagtgttgtggaatggagtggctcgcggtcattc
ttctataaaaagctctatcgtagaattgcagagagctctcttgtgaggaacataagaaaa
gcttctggagacatcttatcatataaatctgctatgggtttgattcaggattggttcagc
aaatctgagattgcaaaggggaaagaagaagcttggacagacgacaaactgttcttcaca
tggaaggacaatgttagtaactatgagcaaaagctgtgtgagttgagagcgcagaaactg
ctgaatcaaattgcagagattgggaattcgtcggatttgcaggctctgccacaaggactt
gctaatcttctaaacaaggtggagctttcaagaagagaagaactggtggatgcgattcga
aaagtgttgaattga

DBGET integrated database retrieval system