KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_474140Help
Entry
ARALYDRAFT_474140 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Brite
Protein kinases [BR:aly01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   ARALYDRAFT_474140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 2482 aa AA seqDB search
MSTSSQSFVAGRPASMASPSQSHRFCGPSATASGGGSFDTLNRVIADLCSRGNPKEGAPL
AFRKHVEEAVRDLSGEASSRFMEQLYDRIANLIESTDVAENMGALRAIDELTEIGFGENA
TKVSRFAGYMRTVFELKRDPEILVLASRVLGHLARAGGAMTSDEVEFQMKTAFDWLRVDR
VEYRRFAAVLILKEMAENASTVFNVHVPEFVDAIWVALRDPQLQVRERAVEALRACLRVI
EKRETRWRVQWYYRMFEATQDGLGRNAPVHSIHGSLLAVGELLRNTGEFMMSRYREVAEI
VLRYLEHRDRLVRLSITSLLPRIAHFLRDRFVTNYLTICMNHILTVLRIPAERASGFIAL
GEMAGALDGELIHYLPTIMSHLRDAIAPRKGRPLLEAVACVGNIAKAMGSTVETHVRDLL
DVMFSSGLSSTLVDALDQITISIPSLLPTVQDRLLDCISLVLSKSHYSQAKPPVTVIRGS
TVGMSPQSSDPSCSAQVQLALQTLARFNFKGHDLLEFARESVVVYLDDEDAATRKDAALC
CCRLIANSLSGITQFGSSRSTRAGGRRRRLVEEIVEKLLRTAVADADVTVRKSIFVSLYG
NQCFDDYLAQADSLTAIFASLNDEDLDVREYAISVAGRLSEKNPAYVLPALRRHLIQLLT
YLELSSADNKCREESAKLLGCLVRNCERLVLPYVAPVQKALVARLSEGTGVNANNNIVTG
VLVTVGDLARVGGLAMRQYIPELMPLIVEALMDGAAVAKREVAVSTLGQVVQSTGYVVTP
YKEYPLLLGLLLKLLKGDLVWSTRREVLKVLGIMGALDPHVHKRNQQSLSGSHGEVPRGT
GDSGQPIPSIDELPVELRPSFATSEDYYSTVAINSLMRILRDASLLSYHKRVVRSLMIIF
KSMGLGCVPYLPKVLPELFHTVRTSDENLKDFITWGLGTLVSIVRQHIRKYLPELLSLVS
ELWSSFTLPGPIRPSRGLPVLHLLEHLCLALNDEFRTYLPVILPCFIQVLGDAERFNDYT
YVPDILHTLEVFGGTLDEHMHLLLPALIRLFKVDAPVAIRRDAIKTLTRVIPCVQVTGHI
SALVHHLKLVLDGKNDELRKDAVDALCCLAHALGEDFTIFIESIHKLLLKHRLRHKEFEE
IHSRWRKREPLIVATTATQQLSRRLPVEVIRDPVIENEIDPFEEGTDRNHQVNDGRLRTA
GEASQRSTKEDWEEWMRHFSIELLKESPSPALRTCAKLAQLQPFVGRELFAAGFVSCWAQ
LNESSQKQLVRSLEMAFSSPNIPPEILATLLNLAEFMEHDEKPLPIDIRLLGALAEKCRV
FAKALHYKEMEFEGPRSRRMDANPVAVVEALIHINNQLHQHEAAVGILTYAQQHLDVQLK
ESWYEKLQRWDDALKAYTLKASQTSNPHLVLEATLGQMRCLAALARWEELNNLCKEYWSP
AEPSARLEMAPMAAQAAWNMGEWDQMAEYVSRLDDGDETKLRGLASPVSSGDGSSNGTFF
RAVLLVRRGKYDEAREYVERARKCLATELAALVLESYERAYSNMVRVQQLSELEEVIEYY
TLPVGNTIAEERRALIRNMWTQRIQGSKRNVEVWQALLAVRALVLPPTEDVETWLKFASL
CRKSGRISQAKSTLLKLLPFDPEVSPENMQYHGPPQVMLGYLKYQWSLGEERKRKEAFTK
LQILTRELSSVPHSQSDILASMVSSKGANVPLLARVNLKLGTWQWALSSGLNDGSIQEIR
DAFDKSTRYAPKWAKAWHTWALFNTAVMSHYISRGQIASQFVVSAVTGYFYSIACAANAK
GVDDSLQDILRLLTLWFNHGATADVQTALKTGFSHVNINTWLVVLPQIIARIHSNNRAVR
ELIQSLLIRIGENHPQALMYPLLVACKSISNLRRAAAQEVVDKVRQHSGALVDQAQLVSH
ELIRVAILWHEMWHEALEEASRLYFGEHNIEGMLKVLEPLHDMLNEGASKDSTTIQERAF
IEAYRHELQEAHECCCNYKITGKDAELTQAWDLYYHVFKRIDKQLASLTTLDLESVSPEL
LLCRDLELAVPGTYRADAPVVTISSFSRQLVVITSKQRPRKLTIHGNDGEDYAFLLKGHE
DLRQDERVMQLFGLVNTLLENSRKTAEKDLSIQRYSVIPLSPNSGLIGWVPNCDTLHHLI
REYRDARKIILNQENKHMLSFAPDYDNLPLIAKVEVFEYALENTEGNDLSRVLWLKSRSS
EVWLERRTNYTRSLAVMSMVGYILGLGDRHPSNLMLHRYSGKILHIDFGDCFEASMNREK
FPEKVPFRLTRMLVKAMEVSGIEGNFRSTCENVMQVLRTNKDSVMAMMEAFVHDPLINWR
LFNFNEVPQLALLGNNNPNAPADVEPEEEDEDPADIDLPQPQRSTREKEILQAVNMLGDA
NEVLNERAVVVMARMSHKLTGRDFSSSAIPSNPIADHNNLLGGDSHEVEHGLSVKVQVQK
LINQATSHENLCQNYVGWCPFW
NT seq 7449 nt NT seq  +upstreamnt  +downstreamnt
atgtctacctcgtcgcaatcttttgtggctggacggcctgcatccatggcttccccgtcg
caatcgcaccgcttttgtggtccctcagccaccgcttctggcggcggaagctttgacact
ttgaatcgtgtcatcgctgacctttgcagccgtggcaatcctaaggagggagctccttta
gcgtttaggaaacatgtagaggaagcagttcgtgatcttagcggggaagcttcctctagg
ttcatggagcagttatatgacaggattgctaatttaattgagagcactgatgtggcggaa
aacatgggtgcactcagagctattgatgagttgacggagattggctttggtgagaatgct
actaaggtttctaggtttgcgggttatatgaggactgtgttcgagttgaagcgtgatcct
gaaatcttggtgcttgctagtagagttttggggcaccttgctcgggcaggtggagcaatg
acttctgatgaagtggagtttcagatgaaaacagcttttgattggcttcgcgtagacagg
gtggaatatcgtcgtttcgccgctgttttaatattaaaggagatggcagaaaatgcttct
actgtctttaacgttcatgtccctgaatttgtggatgctatctgggttgcactaagggac
ccccagttgcaagtgcgagaacgagctgttgaagctttgcgtgcttgccttcgtgttatt
gagaaaagagagactcgatggcgagtgcagtggtactatcggatgtttgaagctacacag
gatgggttgggcagaaatgctccggttcatagtattcatggttctttacttgccgtgggg
gagctgttgaggaatacaggtgagttcatgatgtctaggtatagagaagttgccgaaatt
gtcctcagataccttgaacatcgtgatcgccttgttcgccttagcatcacctcgttactg
cctcgcattgctcactttctccgtgaccgctttgttacaaactatttaacaatatgcatg
aatcatattcttactgtgttaagaataccggctgaacgagccagtgggttcatcgccctt
ggggaaatggctggtgctttggatggtgagcttatccactatttgccgacaattatgtct
catctgcgcgatgcgattgctccacggaaaggtagacctttgcttgaagctgtggcttgt
gttggtaacatcgcgaaggcaatgggatccacagtggaaactcatgttcgagatctttta
gatgttatgttttcatctggtctctcttccacacttgttgacgctcttgatcagataacc
atcagcattccttctttgctgccaacagtacaagatcggcttctagattgcatttcgttg
gttctttcaaaatcccattattctcaagcaaagcctcctgttactgttatccgaggtagt
acagtgggcatgtcaccacagtcttctgaccctagttgttcggctcaagttcaactagcc
ctgcagactcttgctcgtttcaattttaaggggcatgatcttcttgaatttgctcgggag
tcagttgttgtttatttggatgatgaggatgcagccacaagaaaagatgctgctttgtgt
tgttgcagactaattgcaaattctctttctggcatcacacaatttggctcgagcaggtca
acacgagcaggggggagacgcaggcgccttgtggaagagattgtggaaaagcttctccgg
acagccgttgcggatgctgatgtaactgttcgcaagtctatcttcgtttctttatatggc
aaccaatgtttcgatgattatctagcacaggctgatagtttgactgccatttttgcttcc
ttaaatgatgaggaccttgatgttcgagaatatgccatctcagttgctgggaggttatct
gaaaaaaatccagcatacgtacttccagcacttcgtcgccatcttatacagttgttaacc
tatcttgagctgagcagtgcagataacaagtgcagagaagagagtgcgaagctccttggt
tgtttagttcgaaattgtgaacggctcgttcttccatacgtagcccctgtccaaaaggca
cttgttgcaagacttagtgaaggaactggagtgaatgctaacaataatattgtcactgga
gttctcgtaactgttggggatcttgcaagagtgggtggcttggcaatgagacaatatatt
ccggagctgatgcctttaattgttgaagctttaatggatggagctgctgtagcaaaacgt
gaggtggctgtttctactcttggtcaagttgttcaaagtacagggtatgttgtgactcca
tacaaggaatacccattgttgcttggcttactcttgaaactgctgaaaggtgacttagtg
tggtctaccagacgagaagtgctcaaggttcttggaattatgggcgctttggatcctcat
gtgcataaacgtaaccaacaaagtttatcaggatcacatggtgaagttcctcgcggcact
ggtgattcaggtcaacctattccatcaattgatgagttacctgtggaactccggccgtca
tttgctacatcggaggattattactcaacggttgctatcaactcgcttatgcgaattctt
agagatgcatcacttcttagttaccacaaaagggttgttagatctctgatgattattttc
aagtcaatgggattgggatgcgtgccttacttgccaaaggttttacctgagctttttcac
actgttcgaacgtctgatgagaacctgaaggactttatcacatggggtcttgggactctt
gtttccattgtgcgccagcacatacgcaagtatctgccagagctgctctcattagtctct
gaactatggtcatccttcaccttgccaggtcccatacgcccatcacgtggtcttccggtt
ctgcatctactggaacatctttgcttggcacttaatgatgaattcagaacttatcttcca
gtcatccttccatgtttcatccaagtattaggtgatgcggagcggtttaatgattacacc
tatgttcctgatattctccacacactcgaagtgtttggcggaactcttgatgagcacatg
catttactccttcctgcccttattcgattgtttaaagtagatgctcctgtagctataaga
cgcgatgccatcaaaactttgacaagagtaatcccgtgtgttcaggttactggtcatatc
tccgctctcgtgcatcacttgaagctagtattagatgggaagaatgatgagttgcggaag
gatgctgtcgatgcactatgttgtttggcacatgcacttggagaggacttcaccatattc
attgaatcaattcacaagcttttgttgaagcatcgattgcggcataaagaatttgaggaa
attcattctcgctggcggaaacgtgaaccattgattgtagctacaactgcaacccaacaa
ttaagtaggcgactgccagttgaggttatcagggatcctgtaattgagaatgagatcgat
cctttcgaagaaggaactgacagaaaccatcaggttaatgatggtagactacggacagct
ggagaagcttctcaacgcagcaccaaggaagattgggaggaatggatgagacattttagt
attgaattacttaaggagtctccctctccagcattaagaacttgtgcaaaacttgctcag
ttgcagccatttgtcgggagagagttgtttgctgctggctttgtcagttgctgggcacag
ctaaacgagtctagccaaaagcagttagttaggagcttggaaatggccttttcttctcca
aacatccccccagagattttagcgacactactcaatctggcagagtttatggaacatgat
gagaagcctcttcccattgatattcgtcttctgggggctctagctgaaaagtgccgtgtt
tttgccaaagctctgcattataaagagatggaatttgaaggtccacggtccaggaggatg
gatgccaaccctgttgctgttgtcgaggctcttatacacataaataatcagttacaccag
catgaggctgctgtcggcatactaacctatgctcaacaacatcttgatgtgcaattaaaa
gaatcatggtatgagaagctgcagcgctgggacgatgcactcaaggcgtacactttgaaa
gcatctcaaacatcaaatcctcatcttgtgttagaagccacattaggacaaatgagatgt
cttgctgcacttgcacgatgggaagagctcaacaatctctgcaaagagtactggagtcct
gctgagccatccgcgcgtctggaaatggcaccaatggctgcacaagctgcgtggaatatg
ggagagtgggatcaaatggcagaatatgtgtctcggttagatgatggcgatgaaacaaag
cttcggggtttagcaagcccggtttctagtggcgacgggagcagtaatggcacattcttc
agggctgttctgttagttcgaaggggaaagtacgacgaggcgcgcgaatatgttgaaaga
gctagaaaatgtcttgccacagaacttgcagcgctggttttggagagctatgagcgtgcg
tacagcaatatggttcgtgttcagcagctgtcagaactagaggaggtaattgaatattat
acgctgcctgtgggaaatactattgctgaagaacggagagctctaattcgtaatatgtgg
actcagcggattcagggatctaagcgtaatgtggaggtgtggcaagcacttttggctgtc
agggcacttgtgctacctcctacagaagatgttgaaacttggctcaagtttgcctcgctt
tgtcgaaagagtgggagaatcagtcaggcgaaatctactctactcaagctcttaccgttt
gatccagaagtatcgccagaaaacatgcaatatcacggacctccacaagtgatgcttgga
tacttaaaataccaatggtcacttggagaggaacgtaagcgcaaagaggcatttaccaag
ctgcagattctgacgagagagctctcaagtgtgccacattctcaatctgacatactggct
agtatggtatctagcaagggtgcaaatgttccacttcttgcacgtgtaaatctcaaactg
ggaacgtggcagtgggcactttcttccggtttgaatgatgggtctattcaagaaattcgt
gatgcgttcgacaaatctacccgctatgctcctaaatgggctaaagcatggcacacatgg
gcgttattcaataccgcagtgatgtcgcattacatttcaagaggtcaaattgcttcccag
ttcgttgtttctgctgtcactggatatttttattcaatagcatgtgcagcaaatgccaaa
ggagttgatgatagtttacaggacatactgcgtcttctcacattgtggttcaaccatgga
gctacagctgatgtccaaacagcattgaagacaggattcagtcatgtcaacattaacaca
tggcttgttgtgctgcctcaaataattgctaggatacattctaataatcgtgctgtcagg
gaactgatacagtctcttctcattcgcataggcgaaaaccacccacaggcactgatgtat
ccccttctcgttgcatgtaaatcaataagcaatcttcggagagctgcagctcaagaggtg
gttgataaagttcgccagcacagtggtgcactcgtggatcaggcgcaacttgtatcacat
gaacttatcagggttgccatactttggcatgaaatgtggcacgaagctctagaagaagct
agtcgcttgtattttggtgaacataacattgaaggaatgctgaaagtacttgaaccctta
catgatatgcttaacgaaggtgcaagtaaggacagtacgactatacaggaaagagcattt
atagaggcataccgtcacgaactacaagaggcacatgaatgctgttgcaattacaagata
acagggaaagatgctgaacttacacaggcttgggatctttactatcacgttttcaaacgg
attgacaaacagctagcaagtctcacgacattggatttggagtctgtatctcctgagttg
ctgctgtgccgtgacttggagctagcagttcctggaacatatcgtgcagatgcccctgtc
gtgacgatatcatcgttttcacgccaacttgttgttataacctctaaacaaagaccaagg
aaattgactattcatggaaatgatggtgaggactacgccttcttgttgaagggtcatgaa
gatctaaggcaagatgagcgtgttatgcagctttttggtttggtgaacactttgcttgag
aattccagaaaaacagcagaaaaagatctttccatccaacgttattctgtaataccacta
tctcccaatagtggactcatcggatgggttccgaactgcgatacccttcaccatcttatt
cgagagtacagagatgcgcgaaagatcattcttaatcaagaaaataagcatatgttgagt
tttgctccagactatgacaatctaccgcttatagcaaaggttgaagtatttgagtatgct
ctagaaaacacagagggaaatgatctatccagggttctctggttaaaaagtcgctcgtca
gaggtttggctggaaagaagaacaaactatactagaagtttagcagttatgagtatggtt
ggttatattcttgggttaggtgatcgacacccaagtaaccttatgctccatagatacagt
ggaaaaatcttgcatattgattttggagattgttttgaggcttctatgaatagagagaag
tttcctgaaaaggttccattccgcctgacaagaatgcttgtcaaagcaatggaagtcagt
ggtatcgaaggaaacttccgctcaacctgcgaaaacgttatgcaagttctcagaaccaat
aaagatagtgtaatggcaatgatggaagcgtttgtgcatgatcctttaatcaattggcgt
cttttcaatttcaatgaagtccctcaattagcactgctcggtaacaacaaccccaatgct
cctgctgatgttgagcctgaggaagaagatgaagatcccgctgatatagaccttcctcag
cctcaaaggagtactcgagagaaagagattcttcaggctgtgaatatgcttggagatgct
aatgaagttttaaatgagcgtgccgtagttgttatggctcgtatgagtcataagcttaca
gggcgtgatttctcttcgtctgcgattccgagcaatcccattgccgatcataataacttg
ctcggaggagattctcatgaagtcgaacatggtttgtctgtgaaagttcaggttcaaaaa
ctaatcaatcaagccacttcccatgaaaatctctgtcaaaactatgttgggtggtgccct
ttctggtga

DBGET integrated database retrieval system