KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_474280Help
Entry
ARALYDRAFT_474280 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K13413  
mitogen-activated protein kinase kinase 4/5, plant [EC:2.7.12.2]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:aly00001]
 Organismal Systems
  Environmental adaptation
   04626 Plant-pathogen interaction
    ARALYDRAFT_474280
Enzymes [BR:aly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     ARALYDRAFT_474280
Protein kinases [BR:aly01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   ARALYDRAFT_474280
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 363 aa AA seqDB search
MRPIQSPPGVSVPVKSRPRRRPDLTLPLPQRDVSLAVPLPLPPTSGGSAPSSGGSASSAP
STNTNSSSESKNYSDLVRGNRIGSGAGGTVYKVVHRPSSRLYALKVIYGNHEETVRRQIC
REIEILRDVNHPNVVKCHEMFDQNGEIQVLLEFMDKGSLEGAHVWKEQQLADLSRQILSG
LAYLHSRHIVHRDIKPSNLLINSAKNVKIADFGVSRILAQTMDPCNSSVGTIAYMSPERI
NTDLNQGLYDGYAGDIWSLGVSILEFYLGRFPFPVSRQGDWASLMCAICMSQPPEAPPTA
SPEFRHFISCCLQREPGKRRSAMQLLQHPFILRASPSQNRSPQNLHQLLPPPRPLSSSSS
PTT
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgagaccgattcaatcgcctccaggagtttccgttccggttaaaagccgtcctcgtcgc
cgtcctgatcttaccttaccgcttcctcaacgcgatgtttctctcgctgtacctctccct
ctcccacctacttccggtggatctgcgccgtcttctggtggttcagcgtcttcagctccg
tcgacgaacactaacagctcctcagaatcgaagaactattcggatttagtgagaggtaac
cggatcggaagcggagctggtgggacggtttacaaagtggttcaccgtccgagttctcgt
ctatacgcactcaaggtgatatacggtaaccacgaggagacagtgagacgtcagatctgt
agagagatcgagattttgcgagatgtgaatcatccaaacgttgtgaaatgtcacgagatg
tttgatcagaatggtgagatccaggttttgcttgagtttatggataaaggttctttagaa
ggtgctcatgtgtggaaagagcaacaattagctgatctatctcgtcagattcttagtggt
ttagcttatcttcatagccgtcacatagttcatcgtgatatcaaaccatcgaatcttttg
ataaactctgctaagaacgttaagattgcagattttggagtgagtaggatcttggctcag
actatggatccgtgtaattcatctgttggaaccattgcttatatgagtcctgagaggatt
aacactgatttgaatcagggtttgtatgatggttatgctggagatatttggagcttaggt
gttagcattttggagttttacttggggaggtttcctttccctgtgagtagacaaggtgat
tgggcaagtcttatgtgtgccatttgtatgtctcagcctcccgaagctccacctaccgcg
tcgccggagtttcgacattttatctcgtgttgcttgcagagagaaccggggaaaaggaga
agtgcgatgcagctattgcagcatcctttcatattaagagcaagtccgagccagaacagg
tctcctcagaatctacatcaactcttgcctcctcctcgtcctctgtcctcttcttcttct
ccaaccacatag

DBGET integrated database retrieval system