KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_474714Help
Entry
ARALYDRAFT_474714 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ARALYDRAFT_474714
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    ARALYDRAFT_474714
Enzymes [BR:aly01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     ARALYDRAFT_474714
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 309 aa AA seqDB search
MAQEAHGIRLEQRHGKARVRVGRVWRHDHDGSHHFVEWNVSISLLSHCLSSYYRDDNSDI
VATDTMKNTVYVKAKECGDRLSVEEFAILIGKHFCSFYPQVFTAIVSIIEKPWERVSIDG
KPHLHGFKLGSENHTAEARVEKSGALNLTSGIGGLALLKTTQSGFERFIRDKYTVLPETG
ERMLATEVNASWRYSYESVASIPTKGLYFTEKFMDVKKVLVDTFFGPPETGVYSPSVQRT
LYLMGSAVLKRFADVSSIHLKMPNIHFLPVNLSTKENPSMVKFKDDVYLPTDEPHGSIEA
TVSRITSKL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggcacaagaagctcatgggatcagattggagcaaagacatgggaaggctcgtgtgaga
gttggaagagtttggcgtcatgatcatgatggatctcatcactttgttgaatggaatgtt
agcatcagtcttctctctcactgtctctcttcttactatcgtgatgataactctgatatt
gtcgctaccgataccatgaaaaacactgtttatgtgaaagccaaggaatgtggagatcga
ctctcggtggaagaatttgccatacttattgggaaacacttttgctcattttatccacag
gtttttactgctatcgtgagtatcattgagaaaccctgggagcgtgtatccatcgatgga
aaaccacatttacatggtttcaagcttggatccgagaaccatactgcagaggcaagagta
gaaaagtctggtgcactaaatttaacctctggtattggaggactagctctactaaagaca
acccagtcaggatttgagaggtttatcagagacaaatacaccgttctgcctgaaactggc
gagagaatgctggccacagaggttaatgcatcttggaggtactcgtatgagtcagttgca
agcatcccaacaaaaggactctacttcactgagaagttcatggacgtaaagaaagttctg
gtggatactttctttggtccaccagaaactggtgtgtatagcccttctgtgcaacgcact
ctctatctcatgggaagcgccgtactgaaaaggttcgctgatgtatcatcaattcaccta
aaaatgccaaatattcactttctacctgtcaatctatcaaccaaggaaaacccttcaatg
gtgaagtttaaagatgatgtgtacctgccaaccgatgaacctcatggatctatagaagca
accgtaagccgcataacctcgaaactatga

DBGET integrated database retrieval system