KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_474714Help
Entry
ARALYDRAFT_474714 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:aly00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism [PATH:aly00232]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 309 aa AA seqDB search
MAQEAHGIRLEQRHGKARVRVGRVWRHDHDGSHHFVEWNVSISLLSHCLSSYYRDDNSDI
VATDTMKNTVYVKAKECGDRLSVEEFAILIGKHFCSFYPQVFTAIVSIIEKPWERVSIDG
KPHLHGFKLGSENHTAEARVEKSGALNLTSGIGGLALLKTTQSGFERFIRDKYTVLPETG
ERMLATEVNASWRYSYESVASIPTKGLYFTEKFMDVKKVLVDTFFGPPETGVYSPSVQRT
LYLMGSAVLKRFADVSSIHLKMPNIHFLPVNLSTKENPSMVKFKDDVYLPTDEPHGSIEA
TVSRITSKL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggcacaagaagctcatgggatcagattggagcaaagacatgggaaggctcgtgtgaga
gttggaagagtttggcgtcatgatcatgatggatctcatcactttgttgaatggaatgtt
agcatcagtcttctctctcactgtctctcttcttactatcgtgatgataactctgatatt
gtcgctaccgataccatgaaaaacactgtttatgtgaaagccaaggaatgtggagatcga
ctctcggtggaagaatttgccatacttattgggaaacacttttgctcattttatccacag
gtttttactgctatcgtgagtatcattgagaaaccctgggagcgtgtatccatcgatgga
aaaccacatttacatggtttcaagcttggatccgagaaccatactgcagaggcaagagta
gaaaagtctggtgcactaaatttaacctctggtattggaggactagctctactaaagaca
acccagtcaggatttgagaggtttatcagagacaaatacaccgttctgcctgaaactggc
gagagaatgctggccacagaggttaatgcatcttggaggtactcgtatgagtcagttgca
agcatcccaacaaaaggactctacttcactgagaagttcatggacgtaaagaaagttctg
gtggatactttctttggtccaccagaaactggtgtgtatagcccttctgtgcaacgcact
ctctatctcatgggaagcgccgtactgaaaaggttcgctgatgtatcatcaattcaccta
aaaatgccaaatattcactttctacctgtcaatctatcaaccaaggaaaacccttcaatg
gtgaagtttaaagatgatgtgtacctgccaaccgatgaacctcatggatctatagaagca
accgtaagccgcataacctcgaaactatga

DBGET integrated database retrieval system