KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_475071Help
Entry
ARALYDRAFT_475071 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K14454  
aspartate aminotransferase, cytoplasmic [EC:2.6.1.1]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Alanine, aspartate and glutamate metabolism
Cysteine and methionine metabolism
Arginine and proline metabolism
Tyrosine metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Carbon fixation in photosynthetic organisms
Isoquinoline alkaloid biosynthesis
Tropane, piperidine and pyridine alkaloid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
C4-dicarboxylic acid cycle, NAD - malic enzyme type
Class
Metabolism; Overview; Carbon metabolism [PATH:aly01200]
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:aly01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:aly01230]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:aly00710]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:aly00250]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:aly00270]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:aly00330]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:aly00350]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:aly00360]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:aly00400]
Metabolism; Biosynthesis of other secondary metabolites; Isoquinoline alkaloid biosynthesis [PATH:aly00950]
Metabolism; Biosynthesis of other secondary metabolites; Tropane, piperidine and pyridine alkaloid biosynthesis [PATH:aly00960]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 405 aa AA seqDB search
MNSILSSVLPAPKDPVLSVIFACRDDPSPVKLNLSAGTYRTEEGKPLVLDVVRRAEQQLA
NDLSRDKEYLPLNGLPEFNKLSTKLILGDDSPAVKENRVVTIQCLSGTGSLRVGAEFLAT
HNKERVIFVPDPTWGNHPRIFALAGLSVEYFRYYDPKSRGLDFKGMLEDLGAAPPGAIVV
LQACGHNPTGVDPTFEQWEQIRRLVRSKCLLPFFDSAYQGFASGSLDSDAQAVRMFVADG
GECLIAQSYAKNMGLYGERIGALTIVCTSEDVAKKVEDQVLLVVRPMYLTPPIHGASIVA
TILKNSDMYNDWTIELKGMADRIISMRQQLYEAIQARGTPGDWSHIIKHIGMFTFTGLSE
EQVHLIAKEYHIYMTYDGRISMASLSSKTVPQLADAIHAVVTRIA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaattccatcttgtcaagcgtccttcctgctcccaaagatcctgttctcagtgtaatt
tttgcttgtagagatgatcctagtccggtcaagttgaatttgagcgcaggtacctatcga
actgaggaaggaaagcctcttgttcttgatgttgtgagaagagcagagcaacagttagcc
aacgacctgtctagggacaaggaatatcttccccttaatggacttcctgaatttaataaa
ttaagtaccaagcttatcttaggtgatgatagtcccgcagtgaaagagaacagagttgtt
acaatccagtgtttgtctggtactggttctttgagagttggagctgagtttctagcaaca
cacaacaaagaacgtgtcattttcgttccagacccaacttgggggaaccatccccgtatt
tttgctttggcgggtttgtctgtcgagtatttccgctactatgatccgaagagccgggga
cttgacttcaaaggcatgctcgaggatcttggcgctgcacctcctggagctatagtggta
cttcaagcttgtgggcataaccccacaggagttgacccaacattcgaacaatgggaacag
attcgacgactagtgagatcgaaatgcttattacccttctttgatagtgcatatcagggt
tttgctagtggtagccttgactcagatgcacaagcggttcgtatgtttgttgccgatgga
ggtgaatgtttgatagctcaaagttatgccaaaaatatgggtctttatggggagcgtatt
ggcgctcttaccattgtatgcacgtcagaggatgtggctaagaaagttgaggaccaagtg
ctacttgttgtgaggcctatgtatcttaccccacctattcatggtgcatctattgttgcc
acaattctaaaaaacagtgatatgtacaatgactggacaattgagctaaaaggaatggct
gaccgcataattagcatgcgtcaacagttatatgaagctatacaagctagaggaacacct
ggtgattggagtcacattattaaacatattgggatgtttacttttactggattaagtgag
gagcaagttcacttgattgccaaagaatatcacatttacatgacttatgatgggaggata
agcatggcaagtctaagttcgaagacagtgcctcaactcgctgatgctatacatgctgtt
gttactcgtattgcctaa

DBGET integrated database retrieval system