KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_475071Help
Entry
ARALYDRAFT_475071 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K14454  
aspartate aminotransferase, cytoplasmic [EC:2.6.1.1]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Alanine, aspartate and glutamate metabolism
Cysteine and methionine metabolism
Arginine and proline metabolism
Tyrosine metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Carbon fixation in photosynthetic organisms
Isoquinoline alkaloid biosynthesis
Tropane, piperidine and pyridine alkaloid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ARALYDRAFT_475071
   01210 2-Oxocarboxylic acid metabolism
    ARALYDRAFT_475071
   01230 Biosynthesis of amino acids
    ARALYDRAFT_475071
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    ARALYDRAFT_475071
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ARALYDRAFT_475071
   00270 Cysteine and methionine metabolism
    ARALYDRAFT_475071
   00330 Arginine and proline metabolism
    ARALYDRAFT_475071
   00350 Tyrosine metabolism
    ARALYDRAFT_475071
   00360 Phenylalanine metabolism
    ARALYDRAFT_475071
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ARALYDRAFT_475071
  Biosynthesis of other secondary metabolites
   00950 Isoquinoline alkaloid biosynthesis
    ARALYDRAFT_475071
   00960 Tropane, piperidine and pyridine alkaloid biosynthesis
    ARALYDRAFT_475071
Enzymes [BR:aly01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     ARALYDRAFT_475071
Amino acid related enzymes [BR:aly01007]
 Aminotransferase (transaminase)
  Class I
   ARALYDRAFT_475071
Exosome [BR:aly04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ARALYDRAFT_475071
  Exosomal proteins of other body fluids (saliva and urine)
   ARALYDRAFT_475071
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 405 aa AA seqDB search
MNSILSSVLPAPKDPVLSVIFACRDDPSPVKLNLSAGTYRTEEGKPLVLDVVRRAEQQLA
NDLSRDKEYLPLNGLPEFNKLSTKLILGDDSPAVKENRVVTIQCLSGTGSLRVGAEFLAT
HNKERVIFVPDPTWGNHPRIFALAGLSVEYFRYYDPKSRGLDFKGMLEDLGAAPPGAIVV
LQACGHNPTGVDPTFEQWEQIRRLVRSKCLLPFFDSAYQGFASGSLDSDAQAVRMFVADG
GECLIAQSYAKNMGLYGERIGALTIVCTSEDVAKKVEDQVLLVVRPMYLTPPIHGASIVA
TILKNSDMYNDWTIELKGMADRIISMRQQLYEAIQARGTPGDWSHIIKHIGMFTFTGLSE
EQVHLIAKEYHIYMTYDGRISMASLSSKTVPQLADAIHAVVTRIA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaattccatcttgtcaagcgtccttcctgctcccaaagatcctgttctcagtgtaatt
tttgcttgtagagatgatcctagtccggtcaagttgaatttgagcgcaggtacctatcga
actgaggaaggaaagcctcttgttcttgatgttgtgagaagagcagagcaacagttagcc
aacgacctgtctagggacaaggaatatcttccccttaatggacttcctgaatttaataaa
ttaagtaccaagcttatcttaggtgatgatagtcccgcagtgaaagagaacagagttgtt
acaatccagtgtttgtctggtactggttctttgagagttggagctgagtttctagcaaca
cacaacaaagaacgtgtcattttcgttccagacccaacttgggggaaccatccccgtatt
tttgctttggcgggtttgtctgtcgagtatttccgctactatgatccgaagagccgggga
cttgacttcaaaggcatgctcgaggatcttggcgctgcacctcctggagctatagtggta
cttcaagcttgtgggcataaccccacaggagttgacccaacattcgaacaatgggaacag
attcgacgactagtgagatcgaaatgcttattacccttctttgatagtgcatatcagggt
tttgctagtggtagccttgactcagatgcacaagcggttcgtatgtttgttgccgatgga
ggtgaatgtttgatagctcaaagttatgccaaaaatatgggtctttatggggagcgtatt
ggcgctcttaccattgtatgcacgtcagaggatgtggctaagaaagttgaggaccaagtg
ctacttgttgtgaggcctatgtatcttaccccacctattcatggtgcatctattgttgcc
acaattctaaaaaacagtgatatgtacaatgactggacaattgagctaaaaggaatggct
gaccgcataattagcatgcgtcaacagttatatgaagctatacaagctagaggaacacct
ggtgattggagtcacattattaaacatattgggatgtttacttttactggattaagtgag
gagcaagttcacttgattgccaaagaatatcacatttacatgacttatgatgggaggata
agcatggcaagtctaagttcgaagacagtgcctcaactcgctgatgctatacatgctgtt
gttactcgtattgcctaa

DBGET integrated database retrieval system