KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_475671Help
Entry
ARALYDRAFT_475671 CDS       T01578                                 

Definition
ubiquitin carboxyl-terminal hydrolase family 1 protein
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Brite
Enzymes [BR:aly01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     ARALYDRAFT_475671
Peptidases [BR:aly01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   ARALYDRAFT_475671
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 330 aa AA seqDB search
MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNNLRPVYGLIFLFKWQVGEKDD
RPTIQDQVSNLFFANQVINNACATQAILAILLNSPEVDIGPELSALKEFTKNFPSDLKGL
AINNSEAIRAAHNSFARPEPFVPEEQKAATKDDDVYHFISYIPVDGVLYELDGLKEGPIS
LGPCPGDQTGIEWLKMVQPVIQERIERYSQSEIRFNLLAVIKNRKDIYTAELKELQRQRE
QLLQQANTCVDKSEAEAVNALIEEVGSGIEAASDKIVMEEEKFMKWRTENIRRKHNYIPF
LFNFLKLLAEKKQLKPLIEKAKKQKTESST
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggtgcacgattgagtcggatcctggtgtatttacagagcttattcaacaaatg
caagtcaaaggagtgcaggttgaagaattgtattccctggatcttgattctctcaataac
ctcagacccgtatatggtctgatctttcttttcaaatggcaagttggggaaaaagatgat
cgtccaacgatccaagatcaagtttcaaacttgtttttcgcaaatcaggtcattaacaat
gcttgtgcaacccaagcgatcctggctatcctcttgaattctccagaggttgacatcggg
cctgaactatcggcgctgaaagaattcaccaagaactttccatctgaccttaagggtttg
gctatcaataacagtgaggcaattcgggctgctcacaacagtttcgcaaggcctgagcca
tttgtcccagaggaacagaaagctgctacaaaagatgatgacgtataccatttcataagc
tacatacctgtggatggagtcttgtacgagcttgatgggctcaaggaaggacctatcagt
cttggtccatgccccggagaccaaaccggcatcgagtggctgaaaatggttcaaccagtg
atccaagaaaggattgagaggtactcacagagcgagattaggttcaatcttttggctgtc
attaaaaacaggaaggatatctacacagcagaactgaaggagcttcaaaggcagagggaa
cagctgttgcagcaggctaatacttgtgtggacaaaagcgaagcagaagcagttaatgcg
ttgattgaggaggtaggcagtgggatcgaggctgcgagtgataagattgtaatggaggaa
gagaagttcatgaaatggagaacagagaacattaggaggaagcataactacattccgttt
ttgttcaacttcctcaaacttcttgctgagaagaaacagttgaaacctctgattgagaag
gccaagaaacagaaaacagaaagctccacttga

DBGET integrated database retrieval system