KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_475711Help
Entry
ARALYDRAFT_475711 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
  KO
K03245  translation initiation factor 3 subunit J
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly03013  RNA transport
Brite
KEGG Orthology (KO) [BR:aly00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    ARALYDRAFT_475711
Ribosome biogenesis [BR:aly03009]
 Eukaryotic Type
  Pre-40S particles
   Other pre-40S particles
    ARALYDRAFT_475711
Translation factors [BR:aly03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    ARALYDRAFT_475711
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF3_subunit
Motif
Other DBs
NCBI-GeneID: 9324542
NCBI-ProteinID: XP_002888479
UniProt: D7KT46
Position
Unknown
AA seq 222 aa AA seqDB search
MDDWEDEQIAPLPAKVELKSNWDDEDVDVNEIKESWEDDDEEPAQPPVVKPAPEKAPKKA
APKTVEKKGKAIEVPKEEPLDPIVEKLRQQRLVEEADYRSTAELFGVKDEEKNLDMFIPK
SESDFLEYAEMISHRIKPYEKSYHYIALLKTIMRLSLTNMKAADVKDVASSITTIANEKL
KAEKEAAAGKKKGGKKKQLIVDKPDDDLVAGPYDAMDDFDFM
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggatgactgggaggacgagcaaattgcaccacttccagcaaaagttgagcttaaaagt
aactgggatgatgaggatgttgatgtgaatgaaattaaggagtcatgggaggatgatgat
gaagaacctgctcagccgcctgttgtaaaacctgctccggagaaggctcctaagaaagca
gcccccaaaactgttgaaaagaagggtaaagcaatcgaagttcctaaagaagaacctcta
gatcctatagtggagaaacttcgccagcagaggcttgttgaggaagccgactaccggtca
accgctgagctctttggagtgaaggatgaagaaaaaaaccttgatatgtttatccctaag
tctgaaagcgattttttggaatatgctgaaatgatttctcataggattaaaccatatgag
aaaagttatcactatattgcgctgctcaaaacaatcatgagactttcactgaccaacatg
aaagcagcagatgttaaggatgttgcttcgtccattacaacgatagcaaatgaaaaacta
aaggcggagaaagaagctgctgcaggcaaaaagaagggtggaaagaagaaacaacttatt
gtagataaacccgatgacgatctagtggctggtccttatgatgccatggacgacttcgac
ttcatgtag

DBGET integrated database retrieval system