KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_476916Help
Entry
ARALYDRAFT_476916 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:aly04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 502 aa AA seqDB search
MAIKGFACFPILLLLSLFASSIRSEQTKEFVLTLDHSNFTETITKHDFIVVEFYAPWCGH
CQKLAPEYEKAASELSSHNPPLALAKIDASQEANKGLANEYKIQGFPTLKILRNGGKSVQ
DYNGPREAEGIVTYLKKQSGPASVEIKSADSAAEIVGEKNVVAVGVFPKLSGEEFDSFMA
LAEKLRADYDFAHTLDAKVLPRGESVEGPVLRLFKPFDELFVDSKDFNGEALEKFVKESS
IPLVTVFDSDPNNHPYVVKFFDSPATKAMMFVNFTSATAESLKSKYREVATSNKGQGLAF
LVGDAESSQGAFQYFGLEESQIPLIIIQTPDNKKYLKANVEVDQIESWVKDFQDGKVAAH
KKSQPIPAENNEPVKVVVAESLDDIVFKSGKNVLIEFYAPWCGHCQKLAPILDEVALSFQ
NDPSVIIAKLDATANDIPSDTFDVKGFPTIYFRSASGNVVVYEGDRTKEDFINFVEKNSE
KKPISHGEESTKTEETAAKDEL
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggcgattaagggtttcgcgtgttttccgatccttttgttgttatctctgttcgcttcc
tccataagaagcgagcagacgaaggaatttgtcttgactctcgatcactctaacttcacc
gaaaccatcaccaaacacgatttcatcgtcgtcgagttctacgccccttggtgtggtcac
tgccagaagcttgctcctgagtacgagaaggctgcatcagagttgagcagtcataaccca
cctctcgctctcgccaagattgacgctagtcaagaagcaaacaaaggacttgcaaacgag
tacaagattcagggtttccccactcttaagattttgagaaatggagggaaatcagttcaa
gattacaacggacctcgtgaagctgagggtattgtcacttatttgaagaagcaaagtggt
cctgcttctgttgaaattaagtcagctgattctgccgctgagattgtgggtgaaaagaat
gttgttgctgttggagtgttccctaaattatctggcgaggagtttgattctttcatggcc
cttgctgagaaattgcgtgctgactatgatttcgcacacactttggatgccaaggttctt
cctcgtggagagtctgtggaaggacctgtactgaggctattcaagccttttgatgagttg
tttgttgattccaaggacttcaatggggaagctctagagaaatttgtcaaagaatcaagt
attccacttgtcaccgtctttgacagtgatccaaacaaccacccatatgttgtcaaattc
tttgacagccctgccactaaggcaatgatgttcgttaacttcaccagtgcaacagctgaa
tctctaaaatcaaagtaccgtgaagtagctacatccaacaaaggtcaaggtcttgccttc
cttgtcggtgatgctgagagcagccaaggcgctttccagtactttggactcgaagagagc
caaattcccctcatcatcatccagaccccagataacaagaagtatttgaaagccaacgtt
gaggttgaccagattgaatcatgggtcaaggacttccaggacggaaaagttgccgcccac
aaaaaatctcaacctattccagctgagaacaacgaacctgtgaaggttgttgttgccgag
agccttgatgacatagttttcaagtctggaaagaatgtcttgattgagttctatgcacca
tggtgtggacattgtcaaaaacttgctccaatcttggacgaagtggctttgtcattccag
aacgacccaagtgtgatcattgcaaaattggacgcaaccgcaaatgatatcccaagtgat
accttcgatgtgaaaggattcccgaccatttacttcaggtcagcgagcggaaacgttgta
gtgtacgaaggagacaggacaaaggaagacttcataaacttcgttgagaagaacagtgag
aagaagccaatttctcatggagaagagtctaccaagactgaagaaacggccgcaaaagac
gagctgtag

DBGET integrated database retrieval system