KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_476935Help
Entry
ARALYDRAFT_476935 CDS       T01578                                 

Definition
kinase family protein
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Brite
Enzymes [BR:aly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     ARALYDRAFT_476935
Protein kinases [BR:aly01001]
 Serine/threonine protein kinases: Other group
  TTK family
   ARALYDRAFT_476935
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 786 aa AA seqDB search
MDREANLPVQPDKPPKSLVRPILNLETTSSSSSSSPELLRHLQAAFKRHRPLSKMQTTTI
GPRRSVAPQRQASRNTRLVTAEGQRSQDVVTLSQSLAANTLTQDTSNLATSVAGESIENA
SITPPSVSGTVNNMFGQNFNPSDRQLDFGKSAVASLGSNLDIGSQNENDQRKFQSLIGST
LTSQDMEWDATNQAEASHLGACIGSKRQNLQSVDSEISLKSEYKVSSSLAKNHGQLGEFR
NFLNQPKTQCSAVGSSCATTTLIHSSSGPMLNATTHVSRSYAEADSSANPHAVQSQGNLP
SCYPSSKDSNILHTNKDAPPSAIPASTNDPEVRVKERDKSKQQQCTTELEAPVGSSSHGG
DGQANARLPDELLTSVSSQPQKSDKQEKVASSKGPSAPRKRNYDPDLFFKVNGKLYQRLG
KIGSGGSSEVHKVISSDCTIYALKKIKLKGRDYATAYGFCQEIGYLKKLKGKTNIIQLID
YEVTDKTLLQEVLNGTMSNKDGRVKDDGFIYMVLEYGEIDLAHMLSQKWREIEGSDRTID
ENWLRFYWQQILQAVNTIHEERIVHSDLKPANFLLVRGFLKLIDFGIAKAINSDTTNIQR
DSQVGTLSYMSPEAFMCNESDENGNTIKCGRPSDIWSLGCILYQMVYGRTPFADYKTFWA
KFKVITDPNHEITYNQLSNPWLIDLMKKCLAWDRNQRWRIPELLQHPFLAPPIPPEPQVK
IIKLLSLIAESCVSDDDKANSMISQLEQLLTNPAPLPRNDHLDSRDQNQQLLFRVSELCI
QLKDRL
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atggacagggaggctaaccttccggttcaaccggataaacctccgaagagtctggttcgt
cccatcttaaacctggaaaccacttcgtcttcttcctcctcctcgccggaacttctacgg
cacttgcaagccgctttcaaacgccatcgcccactcagtaaaatgcagacgaccactatc
gggcctcgacggagtgttgctccacaacgacaagcttcaagaaatacacgtttggttaca
gctgaagggcagagatctcaggatgttgttacgctcagtcagagtcttgctgctaatact
ttgacacaggatacaagcaatttagccacttctgttgctggagaatctattgagaatgcg
tctattacgccaccttcagtttcaggaactgttaataatatgtttggtcagaatttcaac
ccatcagacagacagttggattttggaaaatctgctgttgctagtctaggaagcaatctt
gatattggatctcagaatgaaaatgaccagagaaagttccaatctctcattggtagcacc
ctcacatctcaagatatggaatgggatgcaacaaatcaggctgaagcatcacatcttggt
gcttgtatcggatcaaaacgtcagaatctccaatctgttgattctgagatcagtttgaaa
tctgaatacaaggtttcatcttcattggcaaagaaccacggtcagctgggtgaatttcgc
aacttcttgaaccaacctaaaactcagtgttctgctgtggggtcatcatgtgccacaact
acgctaatccattcgtcttcaggtcctatgctaaatgccactacccacgtttctcgttct
tatgcagaggctgattcgagtgcaaatccccatgctgttcaaagtcaagggaacttgcct
tcttgttatccttcttccaaggacagcaacatactacataccaataaggatgcccctcca
tcagcgataccagcctcaactaatgatccagaagtaagagtcaaagagagagataagtcc
aagcagcaacagtgcaccacagaacttgaagctccagtgggatcttccagtcatgggggt
gacggacaagcgaatgctcgtctacctgatgagttgcttaccagtgttagctcacagcca
cagaaatcagataagcaggaaaaggttgcaagtagcaaagggccatcagcgcctcgtaaa
agaaattatgatccagacttgttctttaaagtcaatgggaagctttatcagaggcttggc
aagataggaagtggaggaagcagtgaagtccacaaggttatttcttcagattgtaccata
tatgcgctaaaaaagatcaagctcaagggtcgtgactatgctacagcatatggattttgc
caggaaattggatatctaaagaagctgaaagggaaaaccaacatcattcagctaatagac
tatgaggtcacggataagactttactccaggaggttttgaatggcacaatgagtaacaaa
gatggaagagttaaggacgatggatttatatatatggtactagaatatggagaaatcgat
ctggcacacatgttatcccaaaaatggagggaaattgaaggatctgaccggacaattgat
gaaaattggcttcggttctactggcagcaaatacttcaagctgtgaacaccatacatgag
gagcgcattgtgcactctgatttgaaacctgcaaatttccttcttgttcgaggctttcta
aaacttattgattttggaatcgctaaggccatcaatagcgatactacgaatattcaacga
gattcacaggtggggactttaagttacatgtcaccagaagcattcatgtgtaacgaaagc
gacgagaatggaaacactataaaatgtggaagaccatcagatatttggtcacttggttgc
atactataccaaatggtatatggaagaacaccttttgcagattataagaccttctgggca
aagttcaaagtcataaccgatccaaaccacgagattacttacaatcaactctcaaaccca
tggcttatcgacctaatgaagaaatgtctagcttgggaccgtaaccaaagatggagaatc
cctgagcttctccaacatcctttccttgcgccgcccatcccacccgagcctcaagtcaaa
atcattaaacttctcagtctcatagctgaatcttgtgttagtgatgacgataaagccaat
tccatgatctctcagcttgaacaactgcttacaaatcctgctcctcttccaagaaatgat
cacttagattcaagagatcaaaatcagcaacttctctttcgggtttcagaactttgtatt
caactcaaggatcggttatga

DBGET integrated database retrieval system