KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_477069Help
Entry
ARALYDRAFT_477069 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Brite
Enzymes [BR:aly01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     ARALYDRAFT_477069
Transcription factors [BR:aly03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    ARALYDRAFT_477069
Mitochondrial biogenesis [BR:aly03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    ARALYDRAFT_477069
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1705 aa AA seqDB search
MNVQAHMSGQISGQVPNQGTMSQQNGNSQMQNLVGGGAAPAGAGLGPSRVSPVDNDILKL
RQAMRIRIFNILQQKQPSPADEASKAKYMDVARRLEEGLFKIANTKEDYVNQSTLEPRLA
SLIKGRQLNNYNQRHANSSSVGTMIPTPGLQHSGGNPNLMITSSVDATMAGSNNITTSAM
NTGNLLNPGGMLGGNLSNGYQHSSSNFGLGSGGNMSSMSSQRNTGQMMPTPGFVNSSTNN
NSNNGQSYLSVEASNNNGGFSAAPMMVPQTQQQQQQQQQLRQDIGGQNSRMLQNHGSQMG
VGLRPGMQQKMSNVSNSSINGGVGMNAKSVDSGTSYSNPTRNSQQAYDNLQRSGMQGEGY
GTNNSDPFGSGNLYGAVTSVGMMTNTQNANTASFQSVSRSSSSLPHQQPQFQQQPNRFQQ
QPNQFHQQQQQFLHQQQLKQQSQQQQRFISHDAFGQNNVASDMVTHVKHEPGMENPSESI
HSQTPEQFQLSQFQNQYQNNAEDRHGGSQILPVTSQSDMCTSVPQNSQQIQQMLHPQSMA
SDSINGFSNLSVGVKTESGMHGHWQSQSQEHTQMSNSMSNERHIQEDFRQRMSGTDEAQP
NNMSGGSIIGQNRVSTTSESLNPQNPTTTTCRYGNGNRDPRFRNQQKWLLFLRHSRNCKA
PEGKCPDRNCVTVQKLWKHMDSCAAPQCSYPRCRPTKTLINHHRNCKESNCPVCIPVKAY
LQQQANARSLARLKNETDAARSVNGGGISSDTVQTSAGAISCASPGAAISDHLQPSLKRL
KVEQSSQPVDVETESSKSSVVSVTEAQSSQYVERKDHKHSDVRAPSKYFEVKAEVSDVSV
QTRPGFKETKIGITENIPKQRPVSQPDKQDLSDVSPRLENTKVEKEPESLKKENLAESTE
HTSKSGKPEIKGVSLTELFTPEQVREHIRGLRQWVGQSKAKAEKNQAMEHSMSENSCQLC
AVEKLTFEPPPIYCTPCGARIKRNAMYYTVGAGDTRHYFCIPCYNESRGDNILAEGTPIP
KARLEKKKNDEETEEWWVQCDKCEAWQHQICALFNGRRNDGGQAEYTCPYCFIAEVEESK
RKPLPQSAVLGAKDLPRTILSDHIEQRLFKRLKQERTERARAQGKSYDEIPTAESLVIRV
VSSVDKKLEVKPRFLEIFREDSYPTEFAYKSKVVLLFQKIEGVEVCLFGMYVQEFGSECA
FPNQRRVYLSYLDSVKYFRPEVRSYNGEALRTFVYHEILIGYLEYCKLRGFTSCYIWACP
PLKGEDYILYCHPEIQKTPKSDKLREWYLAMLRKASKEGIVAETINLYDHFFMQTGECRA
KVTAARLPYFDGDYWPGAAEDLIYQMSQEEDGRKGNKKGMLKKTITKRALKASGQTDLSG
NASKDLLLMHKLGETIHPMKEDFIMVHLQPSCTHCCILMVSGNRWVCSQCKHFQICDKCY
EAEQRREDRERHPVNFKDKHALYPVEIMDIPADTRDKDEILESEFFDTRQAFLSLCQGNH
YQYDTLRRAKHSSMMVLYHLHNPTAPAFVTTCNACHLDIETGQGWRCEVCPDYDVCNSCY
SRDGGVNHPHKLTNHPSLADQNAQNKEARQLRVLQLRKMLDLLVHASQCRSPHCQYPNCR
KVKGLFRHGIQCKVRASGGCVLCKKMWYLLQLHARACKESECHVPRCRDLKEHLRRLQQQ
SDSRRRAAVMEMMRQRAAEVAGGSG
NT seq 5118 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttcaggctcacatgtcgggacagatatctggccaggttccaaaccaagggacc
atgtcccagcaaaatgggaactcccaaatgcagaatttagttggtggtggtgcagctcct
gctggtgctggtttaggaccttcacgtgtttctcccgttgacaatgacatcttgaaactt
cggcaggccatgcgaatcaggattttcaatatcttacagcaaaaacaaccatctccagct
gatgaagcatcaaaagcaaaatatatggatgttgctagacgcttagaagaggggctgttt
aaaattgctaacacaaaggaagattacgtgaaccagtcaacccttgaacctcggctggca
agtctaatcaaaggcaggcagttaaataactacaatcagcgacacgctaattcttcttcg
gttggaacaatgatacctactccaggattacaacacagtggggggaatcctaatttgatg
attacttcctcagtagatgctacaatggctggaagtaataacatcacaactagtgctatg
aacactggaaacctgctaaatcctggtggcatgctcggaggtaacctatctaatggatac
cagcattcatcgagtaactttggtcttggttctggagggaacatgtcatccatgagctcc
cagagaaatactggccagatgatgcctacccctggatttgtcaacagtagtacaaataac
aacagcaataatggccagtcttacttgagtgttgaagcttccaacaataatggtggattt
tctgctgctcccatgatggtacctcagactcagcagcagcagcaacagcaacagcaactg
aggcaagatattggtggccaaaatagtcgtatgctgcaaaaccatggaagtcaaatgggt
gttggccttagacctggaatgcaacaaaaaatgtctaatgtgtctaacagctccataaat
ggtggtgttggaatgaatgcaaaaagcgtagattcaggtacatcgtactctaatcctacc
agaaattcacagcaggcttatgataaccttcagcgttcaggaatgcagggtgaaggatat
ggcacaaacaactctgacccattcggatcgggaaatttgtatggtgctgtaacatctgtt
gggatgatgacaaatactcagaatgccaatacagcaagtttccagtctgtgtctagaagt
agctcttctttgccacatcaacagccgcagtttcagcaacagcctaatcggtttcagcaa
caacctaatcaatttcaccaacagcagcagcagtttcttcatcaacagcaattgaagcag
caaagccagcagcaacagagatttataagtcacgatgcttttgggcaaaataacgtggct
tctgacatggttactcacgttaaacatgaacctggaatggagaaccctagcgagtctatc
cactcccaaactcctgagcaatttcagctttctcagtttcagaatcaataccagaacaat
gcagaagaccgtcatggaggttctcagattctccctgtcactagtcagagtgatatgtgc
acatcagttcctcaaaatagccaacagatacagcagatgttgcacccgcagagtatggct
tcagactctatcaacggttttagcaacctctctgttggagtgaaaacagaatctgggatg
catggtcactggcaatctcagtcacaggaacatactcaaatgtctaatagtatgtcgaac
gaacggcacatccaggaggatttccgtcaaagaatgtctggaacggatgaagctcagccc
aataatatgtctggaggctccatcataggtcaaaatcgtgtctccactacatcagaatcc
cttaatccccaaaatcctactactaccacttgtagatatggaaacggaaaccgggatccg
agattcagaaatcaacagaaatggctcctctttctacgccattctcgcaactgcaaagcg
cctgaagggaagtgtcccgaccgaaattgtgttacggttcagaagctttggaaacacatg
gacagttgtgctgcacctcaatgttcatatcctcgttgccgccccacaaagacgttgatt
aatcaccatcgaaattgtaaggaatctaactgccctgtctgtattcctgtgaaggcctac
ctacagcaacaggcaaatgcacggtcccttgctcgtttaaaaaatgaaaccgatgcagcc
aggtcagtgaatggtggaggaatatcaagtgatactgtacagacctccgctggagcaata
tcttgtgcttcgcctggtgctgctatttcagatcatttgcaaccttcattaaaacggttg
aaggtggagcagtcttctcaacctgtggatgttgagacagaaagcagtaagagctcagtt
gtttccgtaacagaagcacaatcatctcagtacgttgaaagaaaagatcataagcacagt
gacgtacgtgcaccttcaaagtattttgaagtgaaagctgaggtttctgatgtttctgtc
cagacacgacccggattcaaagagacaaaaattggaattactgaaaatattcccaagcaa
aggcctgtcagtcaacctgataaacaagatttgtctgatgtctcacctaggctagagaat
accaaagtggagaaagaacctgaatcacttaagaaagaaaatctggcagagtctactgaa
catacatcaaaatctggaaaaccagagataaagggtgtttcattaactgaattgttcact
cctgaacaagtgagagaacatatccgtggtctccgtcagtgggttggccagagtaaagcc
aaagctgaaaagaatcaggcaatggagcattcaatgagtgagaattcctgccaactatgt
gcagtggagaagcttacctttgagccaccacctatttattgtaccccttgtggtgctcgc
atcaagagaaatgctatgtattacaccgtaggagctggtgacactcgtcattacttttgt
attccatgttataatgaatcccgtggggacaatatactcgccgaagggacgcctatacct
aaggcaagactcgagaaaaagaaaaatgatgaagagactgaagaatggtgggttcaatgt
gataaatgtgaggcgtggcagcatcagatatgtgctttatttaatgggcgaaggaatgac
ggagggcaggctgagtatacctgcccatattgctttatagcagaagtggaggaaagtaag
aggaagcctttacctcagagtgctgttcttggagctaaagacctaccgagaacaattctc
agtgaccatatagagcagcggttgtttaagaggctgaagcaggaaagaacagagagagcc
agggctcaaggaaaaagttatgatgagattcccactgccgagtcccttgtgattagagtt
gtttcatctgttgacaagaagctggaagtcaaacctcgatttcttgaaatttttcgggag
gatagttacccaacagaatttgcatacaagtccaaggtagttctgttgtttcaaaagatt
gaaggtgtagaagtatgcttatttgggatgtacgtccaagaattcggttctgaatgcgca
tttcccaatcaacgccgagtatatctctcgtatttggattcagtcaagtacttcagaccc
gaggttagatcttataacggagaagctctgcgtacttttgtttaccacgaaattctgatc
ggctacctagaatactgtaagttgcgtggtttcacgagctgctacatatgggcttgtccg
ccgctgaagggcgaggactatatcttatattgtcatccagaaattcagaagacgccaaaa
tctgataaactacgagagtggtacttagcaatgttgagaaaagcttcaaaggagggcatt
gttgcagaaactataaatctatatgaccatttttttatgcaaactggtgaatgtagagct
aaggttacagcagctaggctcccgtattttgatggtgactactggccaggtgcagcggag
gatcttatataccaaatgagtcaagaagaagatggaagaaagggaaataagaaaggaatg
ctcaagaaaaccattaccaaaagggctttaaaagcttctggtcagactgatctatctggg
aatgcgtccaaggatctgctgctaatgcataaactcggtgagaccattcacccgatgaag
gaggactttatcatggtccacttgcagccttcttgcactcattgctgcatactgatggta
tctggtaatcgttgggtctgcagccagtgcaaacacttccagatatgtgacaagtgttac
gaggctgagcagagacgtgaagacagggaaaggcatcctgttaattttaaggataaacat
gcgttgtatcccgttgagattatggatattcctgcagatacgagagataaagatgaaata
ctcgaaagcgagtttttcgacactaggcaagcatttctgagtctttgtcaagggaaccat
tatcagtatgacacgttgaggcgggcaaaacattcgtccatgatggtcctttatcatcta
cataacccaaccgctcctgcctttgtcacaacctgcaatgcgtgtcatcttgacattgaa
actggtcaaggctggcgctgtgaagtatgtccagactacgatgtgtgcaattcctgttac
agtagagatggtggagttaatcatcctcacaagttgactaatcatccatctttagctgat
caaaatgctcaaaacaaagaagcaaggcagttgcgagtcttgcagcttaggaaaatgctt
gatcttctggtacatgcatcacaatgtcgttcgccacattgtcaatatcctaattgccgg
aaagtgaaggggctgttccgacatggtatacagtgcaaagtacgcgcttcgggagggtgt
gttctatgcaagaaaatgtggtatctcctgcaactccatgctcgggcctgcaaggaatcc
gagtgccatgtacctcgttgcagggacctgaaggaacatctgagaagattacagcagcaa
tcagattcacggcgaagagcagctgtaatggaaatgatgagacaaagagctgcagaagtc
gctgggggctcaggttaa

DBGET integrated database retrieval system