KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_477180Help
Entry
ARALYDRAFT_477180 CDS       T01578                                 

Definition
transducin family protein
Orthology
K14298  
mRNA export factor
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:aly00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    ARALYDRAFT_477180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 349 aa AA seqDB search
MATFGASATANINPNKSYEVTPSPADSISSLSFSPRADILVATSWDNQVRCWEISRSGAS
LASAPKASISHDQPVLCSAWKDDGTTVFSGGCDKQAKMWPLLSGGQPVTVAMHDAPIAAM
AWIPGMNLLATGSWDKTLKYWDTRQPNPVHTQQLPDKCYTLSVKHPLMVVGTADRNLIVF
NLQNPQTEFKRIQSPLKYQTRCVTAFPDQQGFLVGSIEGRVGVHHLDDSQQSKNFTFKCH
RDGNEIYSVNSLNFHPVHGTFATAGSDGAFNFWDKDSKQRLKAMSRCNQPIPCSSFNHDG
SIYAYAACYDWSKGAENHNPATAKSSIFLHLPQENEVKAKPRVGATGRK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggctactttcggtgcgtcggctaccgcgaacattaaccctaacaaatcctacgaggtt
actccatcacccgcagattctatttcgagcttaagttttagcccaagagccgatatactt
gtggccacttcatgggacaatcaggtgaggtgttgggaaatatcccgtagtggagcctct
ctagccagtgctcccaaagcatccatctcgcatgatcagccggttttatgttctgcttgg
aaagatgatggaaccacagtctttagcggtggatgtgataagcaagcaaaaatgtggccc
ttgttgtctggtggtcaacctgtgactgttgctatgcacgatgctcctatcgcagctatg
gcttggatcccgggaatgaatcttcttgcaactggaagttgggataaaactttgaaatat
tgggacacaagacagccaaatcctgtgcatacccaacagcttccagataaatgttataca
ttgtctgtgaagcatcctctgatggttgtcggaactgcagatagaaatctgatagtcttc
aacttgcaaaatcctcagactgagtttaagagaattcaatccccactgaagtaccagacg
aggtgtgtgactgccttccctgatcagcaaggatttttggttggttcaattgagggacgg
gttggtgtccatcatctggatgattctcaacagagcaaaaacttcacattcaaatgccac
agagatggaaatgagatatattctgtcaactctctgaatttccacccggtacatggcact
tttgcaactgctggctcagatggtgctttcaatttctgggacaaagatagtaaacaaaga
ctcaaggccatgtcgaggtgcaatcagcctattccttgcagctcgttcaaccacgatgga
tcgatatatgcatatgcggcttgctatgactggagcaaaggtgcagaaaatcacaacccg
gcgactgcaaaaagcagcattttcttgcacctgccacaggaaaacgaggttaaggccaag
ccaagagttggagcaaccggcagaaaatga

DBGET integrated database retrieval system