KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_477206Help
Entry
ARALYDRAFT_477206 CDS       T01578                                 

Definition
At1g80460
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Glycerolipid metabolism
Metabolic pathways
Plant-pathogen interaction
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:aly00561]
Organismal Systems; Environmental adaptation; Plant-pathogen interaction [PATH:aly04626]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 522 aa AA seqDB search
MAKENGFIGSIDQGTTSTRFIIYDHHARAVASHQVEFTQFYPEAGWVEHDPMEILESVKV
CIAKALDKATADGHNVDGGLKAIGLTDQRETTVVWSKSTGLPLHKAIVWMDARTSSICRR
LEKELSGGRSHFVESCGLPISTYFSAMKLLWLMENVDDVKDAIKKGDAIFGTIDTWLIWN
MTGGVDGGLHVTDVTNASRTMLMNLKTLNWDQDTLKTLGIPAEILPKIVSNSEVIGEICK
GWPIPGIKIAGCLGDQHAAMLGQACRKGEAKSTYGTGAFILLNTGEVPIKSGHGLLTTLA
YKLGPQAHTNYALEGSIAIAGAAVQWLRDSLGIIKSASEIEDLAAMVDSTGGVYFVPAFN
GLFAPWWREDARGVCIGITRFTNKSHIARAVLESMCFQVKDVLDSMNKDAGEKGSLDNEK
GEFLLRVDGGATANNLLMQIQADLMGSPVVRPVDIETTALGAAYAAGLAVGFWKEADIFE
SGEKAKNSKVFRPAMEEETRKKKVASWCKAVERTFDLADLSI
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagaaaatggttttataggatcaatcgatcaaggaaccaccagcaccagattc
atcatctacgaccaccatgctcgtgctgttgcatctcatcaagtcgagttcactcagttc
tatcccgaagctggatgggtggaacacgatcctatggagatactggaaagtgtgaaagtg
tgcattgcaaaggctctcgacaaagccactgccgatggacacaacgtcgacggcggcttg
aaggccattgggctgacagatcagagagagacaactgttgtttggagcaaatccactggc
cttcctctccacaaagctattgtgtggatggatgctcgtaccagttccatctgcaggaga
ctagaaaaagaactctcgggaggaagatcccattttgtggagtcttgtggcttgccaata
agcacatatttctctgccatgaagctgctttggctcatggagaatgtggatgacgtcaaa
gacgctatcaagaaaggtgatgccatctttggcactatcgacacatggttgatctggaac
atgactggtggtgtggatggcggcctacatgtcactgatgtcaccaatgcctctcgcaca
atgctcatgaacctcaaaaccttgaactgggaccaggacactttgaagacacttggcata
ccagctgaaatcttgcctaagattgtgagcaattcagaagtgattggagaaatctgcaaa
ggctggcctattcccggtatcaagattgctggatgtcttggtgatcagcatgccgcgatg
ttgggacaagcttgcagaaaaggcgaggccaagagtacatatggaaccggcgctttcatt
cttctcaacaccggagaagtgccaatcaaatcaggccatggacttctgaccacactggcc
tacaagctcgggcctcaagcacataccaactatgcactggagggttcgattgccatagca
ggagctgctgttcagtggcttagagacagccttgggataatcaaaagcgcctctgaaatc
gaagatttggcagcaatggtagattctacaggaggagtgtactttgtgccagcgttcaat
ggcttgtttgcgccttggtggagagaggacgcacgcggtgtttgcattggaatcacgagg
ttcaccaacaagtctcacattgctcgggcagtactggagagcatgtgtttccaagtgaaa
gacgtccttgactccatgaacaaagatgcaggtgaaaagggttccctagataacgagaaa
ggggagttcttgctcagagttgatggtggtgccacagctaataaccttctgatgcagatt
caggctgatttgatggggagtccggtggtgaggcctgtggacatagagacaacagcacta
ggagcagcctatgcagctgggttggctgtgggattctggaaggaagcagacatattcgag
tcaggagagaaggcgaagaactccaaagttttcagacctgctatggaagaagaaaccagg
aagaagaaagtggcgtcttggtgcaaagcagtggaaagaacatttgatctcgctgatctc
tctatctaa

DBGET integrated database retrieval system