KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_477206Help
Entry
ARALYDRAFT_477206 CDS       T01578                                 

Definition
At1g80460
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Glycerolipid metabolism
Metabolic pathways
Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    ARALYDRAFT_477206
 Organismal Systems
  Environmental adaptation
   04626 Plant-pathogen interaction
    ARALYDRAFT_477206
Enzymes [BR:aly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     ARALYDRAFT_477206
Exosome [BR:aly04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ARALYDRAFT_477206
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 522 aa AA seqDB search
MAKENGFIGSIDQGTTSTRFIIYDHHARAVASHQVEFTQFYPEAGWVEHDPMEILESVKV
CIAKALDKATADGHNVDGGLKAIGLTDQRETTVVWSKSTGLPLHKAIVWMDARTSSICRR
LEKELSGGRSHFVESCGLPISTYFSAMKLLWLMENVDDVKDAIKKGDAIFGTIDTWLIWN
MTGGVDGGLHVTDVTNASRTMLMNLKTLNWDQDTLKTLGIPAEILPKIVSNSEVIGEICK
GWPIPGIKIAGCLGDQHAAMLGQACRKGEAKSTYGTGAFILLNTGEVPIKSGHGLLTTLA
YKLGPQAHTNYALEGSIAIAGAAVQWLRDSLGIIKSASEIEDLAAMVDSTGGVYFVPAFN
GLFAPWWREDARGVCIGITRFTNKSHIARAVLESMCFQVKDVLDSMNKDAGEKGSLDNEK
GEFLLRVDGGATANNLLMQIQADLMGSPVVRPVDIETTALGAAYAAGLAVGFWKEADIFE
SGEKAKNSKVFRPAMEEETRKKKVASWCKAVERTFDLADLSI
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagaaaatggttttataggatcaatcgatcaaggaaccaccagcaccagattc
atcatctacgaccaccatgctcgtgctgttgcatctcatcaagtcgagttcactcagttc
tatcccgaagctggatgggtggaacacgatcctatggagatactggaaagtgtgaaagtg
tgcattgcaaaggctctcgacaaagccactgccgatggacacaacgtcgacggcggcttg
aaggccattgggctgacagatcagagagagacaactgttgtttggagcaaatccactggc
cttcctctccacaaagctattgtgtggatggatgctcgtaccagttccatctgcaggaga
ctagaaaaagaactctcgggaggaagatcccattttgtggagtcttgtggcttgccaata
agcacatatttctctgccatgaagctgctttggctcatggagaatgtggatgacgtcaaa
gacgctatcaagaaaggtgatgccatctttggcactatcgacacatggttgatctggaac
atgactggtggtgtggatggcggcctacatgtcactgatgtcaccaatgcctctcgcaca
atgctcatgaacctcaaaaccttgaactgggaccaggacactttgaagacacttggcata
ccagctgaaatcttgcctaagattgtgagcaattcagaagtgattggagaaatctgcaaa
ggctggcctattcccggtatcaagattgctggatgtcttggtgatcagcatgccgcgatg
ttgggacaagcttgcagaaaaggcgaggccaagagtacatatggaaccggcgctttcatt
cttctcaacaccggagaagtgccaatcaaatcaggccatggacttctgaccacactggcc
tacaagctcgggcctcaagcacataccaactatgcactggagggttcgattgccatagca
ggagctgctgttcagtggcttagagacagccttgggataatcaaaagcgcctctgaaatc
gaagatttggcagcaatggtagattctacaggaggagtgtactttgtgccagcgttcaat
ggcttgtttgcgccttggtggagagaggacgcacgcggtgtttgcattggaatcacgagg
ttcaccaacaagtctcacattgctcgggcagtactggagagcatgtgtttccaagtgaaa
gacgtccttgactccatgaacaaagatgcaggtgaaaagggttccctagataacgagaaa
ggggagttcttgctcagagttgatggtggtgccacagctaataaccttctgatgcagatt
caggctgatttgatggggagtccggtggtgaggcctgtggacatagagacaacagcacta
ggagcagcctatgcagctgggttggctgtgggattctggaaggaagcagacatattcgag
tcaggagagaaggcgaagaactccaaagttttcagacctgctatggaagaagaaaccagg
aagaagaaagtggcgtcttggtgcaaagcagtggaaagaacatttgatctcgctgatctc
tctatctaa

DBGET integrated database retrieval system