KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_477538Help
Entry
ARALYDRAFT_477538 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:aly00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    ARALYDRAFT_477538
   03420 Nucleotide excision repair
    ARALYDRAFT_477538
   03430 Mismatch repair
    ARALYDRAFT_477538
   03440 Homologous recombination
    ARALYDRAFT_477538
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 278 aa AA seqDB search
MYGGEFDGNAAFAGGGFMPSQATTQAHDSSSSLKNRDVRTLLPLTLKQLSSASTTGESNF
SIDGVDINTVAIVGRISRMENRITQVEFVVDDGTGWVDCVRWCQERQETEEMEAVKLGMY
VRLHGHLKIFQGKRSVNVFSIRPVTDFNEIVHHFTECMYVHMYNTKLRGGSITQATTTPR
PQMPYSTMPTPAKPYQTGPSNQFPNQFNDPMHGVKQTVLNYLNQPMHLVSEAGVHCDIIA
RDLRIPLPQVKDALEQLSNDGCIYSTMDETCFKSTANA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgtacggaggcgagtttgacggcaacgctgctttcgccggcggcggtttcatgccttct
caggcaactacgcaagcgcatgactcctcctcgtccctcaagaaccgcgatgtacgtacc
ttgcttcccctgacactgaagcagttgagcagtgcatcaactactggtgaatcaaatttc
tctattgatggcgttgatattaacactgttgccattgttggacggatttctagaatggag
aacagaatcactcaggtcgaatttgttgttgatgacggtacaggctgggttgattgtgtc
agatggtgtcaagagcgtcaagaaaccgaagaaatggaagcagtcaagctgggaatgtat
gttcgcttacatggacacctgaaaatttttcaagggaagcgatctgtgaatgttttctca
atcaggcctgtcactgacttcaatgagattgtacaccactttacggagtgtatgtatgtc
cacatgtacaacaccaagttacggggtggctctattactcaggctactactactcctagg
cctcaaatgccatattcaacaatgccaacccctgcaaagccataccaaaccggtccatct
aatcagttcccgaaccaattcaatgatccaatgcatggtgtaaagcagacggtcttgaat
tacctgaatcaacctatgcacctcgtatctgaagctggtgttcactgtgatataattgcg
cgtgacctcaggattccgctgcctcaagtcaaggatgcgttagaacagctctcaaacgat
ggttgcatttactcgactatggacgagacatgcttcaaatcgacagctaacgcttga

DBGET integrated database retrieval system