KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_477571Help
Entry
ARALYDRAFT_477571 CDS       T01578                                 

Gene name
UGP
Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:aly00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:aly00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:aly00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:aly00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 469 aa AA seqDB search
MAATTENLPQLKSAVDGLSEMSENEKSGFIGLVSRYLSGEAQHIEWSKIQTPTDEIVVPY
EKMASVSQDVSETKNLLDKLVVLKLNGGLGTTMGCTGPKSVIEVRDGLTFLDLIVIQIEN
LNNKYGCKVPLVLMNSFNTHDDTQKIVEKYTHSNVDIHTFNQSKYPRIVADEFVPWPSKG
KTDKEGWYPPGHGDVFPALMNSGKLDTFLSQGKEYVFVANSDNLGAIVDLTILKHLIQNK
NEYCMEVTPKTLADVKGGTLISYEGKVQLLEIAQVPDEHVNEFKSIEKFKIFNTNNLWVN
LKAIKKLVEADALKMEIIPNPKEVDGVKVLQLETAAGAAIRFFDNAIGVNVPRSRFLPVK
ASSDLLLVQSDLYTLVDGFVTRNKARTNPSNPSIELGPEFKKVANFLSRFKSIPSIVELD
SLKVSGDVWFGSSVVLKGKVTVTAKSGVKLEIPDRAVVDNKNINGPEDL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggccgccaccaccgagaatctccctcaactcaaatccgccgtcgatggcctttctgag
atgagtgagaatgagaagagcggattcatcggcctcgtttcacgttacctaagcggtgag
gcacagcacattgagtggagtaagatccagacacctactgatgaaatcgttgttccctac
gagaaaatggcttccgtctcccaagatgtttccgagaccaagaatctcttggacaaactt
gttgtgttaaagcttaatggaggtcttgggacaacaatgggatgcactggccccaagtcg
gttatcgaagttcgtgatggtttgacatttcttgatctgattgttatccagattgagaat
ctcaacaacaagtatggctgcaaggttccgttggttctcatgaactcatttaatacacat
gatgacacacaaaagattgtggaaaagtacacccactcaaatgttgacattcacacattt
aaccagagcaaatatccccgtattgtggcagatgagtttgtgccatggcccagcaaggga
aagaccgacaaggagggctggtatcctcctggtcatggtgatgtattcccagccctcatg
aacagtggaaagctcgatactttcttatcacagggtaaggaatatgtgtttgttgccaat
tcagacaacttgggtgccatcgttgacttaacaatcctgaagcatttgatccagaacaag
aacgagtactgcatggaagttacacccaaaaccttagctgatgtaaagggaggaactctc
atttcttatgaaggcaaagtccagcttctggagattgctcaggttcctgatgaacatgtc
aatgaattcaaatcaattgagaagttcaagatattcaacacaaacaacttatgggttaac
ttgaaggccatcaaaaagcttgtggaagctgatgcacttaaaatggagatcattccaaac
ccaaaggaagttgatggagtcaaagttcttcaactggaaactgcagctggtgctgcgata
aggttctttgacaatgctatcggtgttaatgtacctcgttcacggttcttgccagtgaag
gcaagctcggacttgctgctcgtccagtctgatctctacacgctagttgatggcttcgtt
acccgaaacaaagctagaactaacccctcaaacccatcaattgaattgggacctgagttc
aagaaggtggctaatttcttgagccggtttaagtccattcctagtatagtcgagctcgac
agccttaaggtgtctggggatgtctggtttggctcttcggttgttctcaagggcaaggta
actgtgactgcaaaatccggtgtgaagctcgaaattccggacagggccgtggtcgacaac
aagaacatcaatggtccagaagacctctga

DBGET integrated database retrieval system