KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_478046Help
Entry
ARALYDRAFT_478046 CDS       T01578                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ARALYDRAFT_478046
Enzymes [BR:aly01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     ARALYDRAFT_478046
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 466 aa AA seqDB search
MGALDEGHLNLDLDIGMKNGCIDLAFELQPETLAIQDAVKLLLQALHEDVNREGIKKTPF
RVAKALREGTRGYKLKVKDYVQSALFPEAGLDEGVGQAGGVGGLVVVRDLDHYSYCECCL
LPFHVRCHIGYVPSGQRVLGLSKFSRVTDVFAKRLQDPQRLADDICSALQHWVKPAGVAV
VLECSHIHFPSLDLDSLHLSSHRGFAKLLVSSGSGVFEDESSNLWGEFRSFLMFKGVKTQ
ALCRNGSSVEEWCPSVKSSSKFSPEEDPEMVSAVVSILKSLGEDPLRKELIATPTRFLKW
MLNFQRTNLEMKLNGVNSAKVNGEVKEKRLHCELNMPFWSMCEHHLLPFYGVVHIGYFCA
EGSNHNPIGSSLMKSIVHFYGFKLQVQERMTRQIAETLSPLVGGDVIVVAEAGHTCMISR
GIEKFGSSTATIAVLGRFSSDNSARAMFLDKIHTTNALKTDSGSPF
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgggcgctttagatgagggacatttgaatctggaccttgacattggaatgaaaaatggc
tgcattgaccttgctttcgagctccaacctgagactttagcaatccaagacgctgtcaaa
cttctcttgcaagctcttcatgaggatgtcaatcgggaaggcatcaaaaagactcctttc
cgtgtcgccaaggcccttcgagaagggaccagaggttataagctaaaggtgaaggactat
gtacagagtgctctgtttccagaagcagggttggatgaaggagttgggcaagcaggagga
gtgggaggacttgtcgttgtcagagatctcgatcattactcttactgcgaatgttgcttg
cttccttttcatgtgaggtgtcacataggttatgtcccatcgggccaacgagtgttagga
ctgagcaagttctctcgagtcactgatgttttcgccaagcggctccaagaccctcagcgt
ttggctgatgatatttgttcagctctccaacattgggtcaaaccggctggagtcgctgtt
gttctcgaatgctctcacattcacttcccgagtttggacttggactctctgcacttgtcg
agccaccgtggatttgcgaagctactggtttcctcgggctcaggagttttcgaggatgaa
agctcgaatctttggggtgaatttcggagtttcttgatgttcaaaggtgtaaaaacgcaa
gctttgtgcagaaatggcagctccgtggaagagtggtgcccgagcgttaaaagctcgtct
aaattctcacctgaagaagacccggaaatggtttctgctgttgtttccatcctgaaatca
ctgggagaagatccgttgaggaaagaactcattgctacaccaactcgattcctcaaatgg
atgttgaacttccaaagaaccaacctcgagatgaagctaaacggcgttaactctgccaaa
gtcaacggcgaggtcaaagagaaaaggctgcactgtgaactgaacatgcccttctggtca
atgtgtgagcatcatttgcttcctttctatggagttgttcatattggctacttttgtgct
gaaggatccaaccacaatcctattggaagttcactcatgaaatcgattgtacacttttat
gggttcaagcttcaagtgcaagagaggatgactcgacagatcgctgagacgctatcgcct
cttgttggcggggatgtgattgttgtggcggaagctgggcatacttgtatgatctctaga
ggaattgagaagtttggaagcagcactgcaacaatcgcagttttgggtcggttttcgagt
gacaattccgcaagagccatgtttctagacaagattcatacaactaatgccttgaagaca
gattcaggctctccattttga

DBGET integrated database retrieval system