KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_478188Help
Entry
ARALYDRAFT_478188 CDS       T01578                                 

Definition
RAPTOR1B
Orthology
K07204  
regulatory associated protein of mTOR
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1344 aa AA seqDB search
MALGDLMVSRFSQSSVSLVSNHRYDEDCVSSHDDGDSRRKDSEAKSSSSYGNGTTEGAAT
ATSMAYLPQTIVLCELRHDASEASAPLGTSEIALVPKWRLKERMKTGCVALVLCLNITVD
PPDVIKISPCARIEAWIDPFSMAPPKALETIGKNLSTQYERWQPRARYKVQLDPTVDEVR
KLCLTCRKYAKTERVLFHYNGHGVPKPTANGEIWVFNKSYTQYIPLPISELDSWLKTPSI
YVFDCSAARMILNAFAELHDMGSSGSSGSSRDCILLAACDVHETLPQSVEFPADVFTSCL
TTPIKMALKWFCRRSLLKEIIDESLIDRIPGRQNDRKTLLGELNWIFTAVTDTIAWNVLP
HELFQRLFRQDLLVASLFRNFLLAERIMRSANCNPISHPMLPPTHQHHMWDAWDMAAEIC
LSHLPQLVLDPTVEFQPSPFFTEQLTAFEVWLDHGSEHKKPPEQLPIVLQVLLSQCHRFR
ALVLLGRFLDMGSWAVDLALSVGIFPYVLKLLQTTTNELRQILVFIWTKILALDKSCQID
LVKDGGHTYFIRFLDSSGAFPEQRAMAAFVLAVIVDGHRRGQEACLEANLIGVCLGHLEA
SRPSDPQPEPLFLQWLCLCLGKLWEDFMEAQIMGREANAFEKLAPLLSEPQPEVRAAAVF
ALGTLLDIGFDSNKSVVEDEFDDDEKIRAEDAIIKSLLDVVSDGSPLVRAEVAVALARFA
FGHKQHLKLAAASYWKPQSSSLLTSLPSIAKFHDPGSATIVSLHMSPLTRASTDSQPVAR
ESRISSSPLGSSGLMQGSPLSDDSSLHSDSGMMHDSVSNGAVHQPRLLDNAVYSQCVRAM
FALAKDPSPRIASLGRRVLSIIGIEQVVAKPSKPTGRPGEAATTSHTPLAGLARSSSWFD
MHAGNLPLSFRTPPVSPPRTNYLSGLRRVCSLEFRPHLLSSPDSGLADPLLGVSGSERSL
LPLSTIYSWSCGHFSKPLLGGADASQEIAAKREEKEKFALEHIAKCQHSSISKLNNNPIA
NWDTRFETGTKTALLHPFSPIVVAADENERIRVWNYEEATLLNGFDNHDFPDKGISKLCL
VNELDDSQLLVASCDGSVRIWKNYATKGKQKLVTGFSSIQGHKPGARDLNAVVDWQQQSG
YLYASGEVSTVTLWDLEKEQLVRSIPSESECGVTALSASQVHGGQLAAGFADGSLRLYDV
RSPEPLVCATRPHQKVERVVGLSFQPGLDPAKVVSASQAGDIQFLDLRTTRDTYLTIDAH
RGSLTALAVHRHAPIIASGSAKQLIKVFSLQGEQLGRIRYYPSFMAQKIGSVSCLTFHPY
QVLLAAGAADSFVSIYTHDNSQAR
NT seq 4035 nt NT seq  +upstreamnt  +downstreamnt
atggcattaggagacttaatggtgtctcggttctcgcaatcttctgtttctttggtctcc
aatcaccgttacgacgaagactgtgtttctagtcacgatgacggtgattcacggaggaag
gattctgaggctaagagcagtagtagctacgggaatggtacaacggagggagccgccacc
gctaccagcatggcatacttgcctcagactattgtgctctgcgagcttagacacgacgca
tccgaggcttctgcgcccttggggacttctgagatcgcattggtccccaaatggcggctt
aaagaacgaatgaaaacaggatgtgtagctttagttttgtgtttgaatattactgttgat
ccgccggatgtaataaagatatctccatgtgctagaatcgaggcatggatagatccattt
tccatggcaccgcctaaagctcttgagacaattggaaaaaatttgagtactcagtatgag
agatggcaaccaagggcccgctataaggttcagctagatccgacagtagatgaggtgagg
aagctgtgcttgacttgtcggaaatatgcaaagaccgagagagttctattccattataat
gggcatggtgtgccaaagcctacagctaatggtgaaatttgggtattcaacaagagttat
acacagtacattcccttgccaatcagtgagcttgattcctggctgaagacaccctccatc
tatgtttttgactgctctgctgctaggatgattcttaatgcctttgctgagcttcatgat
atgggttcttctggttcctctggatcctcaagggactgcattctgcttgctgcttgtgat
gtacatgagacacttccacagagcgttgagtttccagctgatgtttttacgtcttgcctc
acaacgcccattaaaatggcgttgaaatggttctgcaggcgttcgcttctgaaagaaatc
atcgatgaatcacttattgaccggattccaggccggcaaaatgaccgtaagacattgtta
ggggagttgaactggatttttacagcagtgacggatacaattgcatggaatgtgcttcct
catgaacttttccagagattattcagacaggacttgttggtcgctagccttttccggaat
ttcttacttgctgagagaataatgcggtccgcaaactgtaatccaatatctcaccctatg
ctgcctcctacgcatcaacatcatatgtgggatgcatgggacatggctgctgaaatctgt
ctttctcaccttccccaacttgttctggacccaaccgtagaattccagccaagtccgttt
ttcactgagcaattgacagcttttgaggtgtggcttgatcatggatctgagcataagaag
ccaccggagcagttacccattgttcttcaggtgttacttagccagtgccatcggtttcgt
gctcttgtacttcttggaagatttcttgatatgggttcatgggctgtggatctggccttg
tctgttggaatattcccatatgtgctgaagcttctgcaaacaacaacgaatgagctaaga
cagattctggttttcatatggacaaagattcttgcacttgataagtcatgtcaaattgat
cttgtgaaggatggggggcatacatatttcatacgatttctagatagctcgggtgcattt
ccagaacaacgagctatggctgcttttgttctggctgtcattgttgatggacatcgacga
ggccaggaagcatgtcttgaagctaatttaattggtgtttgtctgggacaccttgaagca
tccagaccaagtgatccacagcctgaaccattgtttctacaatggctttgtctttgtctt
ggaaagttatgggaagattttatggaggcccaaataatgggcagggaggctaatgctttt
gaaaagttggcacctctgctttccgagccccaacctgaggtaagggctgctgctgttttt
gccctgggtaccttgcttgatattgggtttgactctaataaaagtgtggtggaggatgaa
tttgatgatgatgaaaagattagagccgaagacgctatcattaaaagtctcttagatgta
gtttcagatgggagtccacttgtccgagcagaggttgccgtagctcttgcacgttttgcc
tttggccacaaacagcaccttaagttagccgcagcttcctattggaagcctcagtcaagt
tctttgcttacttctctcccttcaatagctaaattccatgatcctgggagtgcaacaatt
gtttctttacacatgagtcctctgactagagctagcacggatagccaaccagtggctcgt
gagtctaggatctcaagcagccctcttggctcttctgggctgatgcaaggatctccatta
tctgatgattcttcattacattctgattctggaatgatgcatgacagtgtcagcaatgga
gcggtccatcagccaagactgttggacaacgctgtttattcgcagtgcgttcgagctatg
tttgcattagctaaagatccatctccacgtattgcaagtctcggacggcgtgtgctttct
attattggaatcgaacaggttgttgcgaaaccctcgaagcccactggccgaccaggggaa
gctgcaacgacatctcacactccacttgctggcctagctcgttcatcctcatggtttgat
atgcatgcaggtaatctgcccttaagttttaggactcccccggtcagcccccctagaaca
aactatctaagtggactgaggagagtttgttcattagagttcaggcctcatctattgagt
tcacccgactcagggttggctgatccgcttttaggcgtcagtggatctgaacggagtttg
cttccactatcaactatctacagctggagttgtggccacttttctaaaccgcttcttggt
ggtgcggatgctagtcaagagattgcagccaaaagagaagagaaagaaaaattcgcactt
gagcatattgcaaaatgccagcactcctctattagcaagctcaacaataatcctattgcc
aactgggatacgaggtttgaaacgggaacaaagacagcactccttcacccattctctcct
attgtagttgctgcagacgagaatgaacggatcagagtgtggaactatgaggaagcaact
cttctcaatggctttgacaatcatgattttcctgacaaaggaatttcaaagctttgcctc
gtcaatgaacttgacgactctcagctacttgttgcgtcatgcgatgggtcggtccggata
tggaaaaactatgcaactaagggtaaacaaaagcttgttactgggttttcttcaatccag
ggtcacaagcccggtgcacgtgacttgaacgctgttgtggactggcaacaacagtccggt
tacctgtatgcttctggggaggtgtcaacagtcacactttgggacctggagaaagaacag
cttgtcagatctattccctctgaatcagagtgtggagttacagcactttccgcttctcaa
gtacacggaggccaacttgctgctggttttgccgatggatctttgagactctatgatgtt
cggtcacctgaaccgcttgtctgcgcgactcggcctcatcagaaagttgaaagggtggtt
ggactcagttttcaacctggacttgatcccgcaaaggtggtgagtgcatcgcaggccggt
gacatacagtttcttgaccttagaacaacaagggacacatacctgacaattgatgcacac
aggggttcactcacggctttagctgttcacagacacgctccaataatcgcgagcggatct
gcaaaacagctcattaaagtgttcagccttcaaggggaacaactagggagaatccgctac
tacccgtctttcatggcacaaaagattggttcagtgagttgcctcacatttcatccgtac
caggttctgctagcagctggagctgctgactcattcgtctccatatacacccacgacaac
tcgcaagcaagatga

DBGET integrated database retrieval system