KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_479084Help
Entry
ARALYDRAFT_479084 CDS       T01578                                 

Definition
binding protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:aly00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    ARALYDRAFT_479084
Protein phosphatases and associated proteins [BR:aly01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     ARALYDRAFT_479084
Ubiquitin system [BR:aly04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     ARALYDRAFT_479084
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 717 aa AA seqDB search
MENLLANCVQKNLNHFMFTNAIFLCERLLAQFPSEVNLQLLARCYLSNSQAYSAYYILKG
SKMPQSRYLFAFSCFKLDLLGEAEAALLPSEDYVEEVPGGAAGHYLLGLIYRHSGRKNSS
IQQFRMALSFDPLCWEAYGELCSLGAAEEASTVFGNVASQRLQITCVEQRINFSEGATVN
QLTDSDKASKDTSLWQTEHFPGENQEDLKIKQQPGADIPPDTDRQLNTNGWDLNTPSPVL
SQVMDAPSPLLHKNMRRPAVEGSLMSVHGVRARRRNFFSEELSAEALEESGRRRSARIAA
RKKIPMSQSFGKDSHWLHLSPSETNCAPSLSSVIGKCRTQSSKEATTSGQSVSDIGSSVD
DEEKSTPSESSPDRFSLISGISEVLNLLKILGDGHRHLHMYNCQEALLAYQKLSQKQYDT
HWVLLQVGKAYFELQDYFNADSVFTLAHQKYPYALEGMDTYSTVLYHLKEEMRLGYLAQE
LISVDRLSPESWCAVGNCYSLRKDHDTALKMFQRAIQLNERFTYAHTLCGHEFAALEEFE
DAERCYRKALGIDTRHYNAWYGLGMTYLHREKFEFAQHQFQLALQINPRSSVIMCYYGIA
LHESKRNDEALMMMEKAVLTDVKNPLPKYYKATILNSLGDYHKAVKVLEELKECAPQESS
VHALLGKIYNQLKQYDKAVLHFGIALDLSPSPSDAVKIKTYMERLILPDELATEENL
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atggagaatctactggcgaattgtgtccagaaaaacctcaaccattttatgttcaccaat
gccatcttcctttgcgaacgtcttctcgcccaatttccctctgaggtgaacctgcaattg
ttagctaggtgttacttgagtaacagtcaagcttatagtgcatattatatcctcaaaggt
tcaaaaatgcctcagtctcggtatttatttgcattctcatgctttaagttggatcttctt
ggagaggctgaagctgcattgttgcccagtgaagattatgttgaagaagttcctggtggt
gcagctgggcattatcttcttggtcttatatatagacattctgggaggaagaacagttca
atacaacagtttaggatggcattgtcatttgatccattgtgttgggaagcatatggagaa
ctttgtagtttaggtgccgctgaagaagcctcaacagttttcgggaatgttgcttcccag
cgtcttcagataacttgtgtagaacaaagaataaacttctcagaaggagcaaccgtaaac
cagcttacagattctgataaggcttcaaaagatacaagtttatggcaaacagaacacttt
ccaggagagaaccaagaagatctgaaaataaagcagcagcctggagcagatattccgcca
gatactgacaggcaacttaatacaaatggatgggacttgaacacaccttctccagtgctt
tcgcaggtaatggatgctccatcgcctctgcttcataagaatatgcgtcgtccagcagtg
gaaggatctttgatgtctgtacatggagtgcgtgcgcgtcgaagaaacttttttagtgaa
gaattgtcagcagaggctctagaagaatctgggcgtcgccgtagtgctagaatagcagca
aggaaaaagattcctatgtcgcagtcatttggaaaagattcccattggttacatctttca
ccttctgagacaaactgtgcaccttctctttcctccgtgattggaaaatgcagaacccaa
agcagcaaggaagcaacgacatcaggccagtctgtaagtgacattggaagctctgttgat
gatgaggaaaagtcaactcctagtgaatcttccccggatcgtttcagcctcatttctgga
atttcagaagtgctaaaccttctgaaaattcttggagatggccataggcatttacatatg
tacaactgtcaggaagctttgttggcatatcaaaagctatctcagaaacaatacgataca
cactgggttctcttgcaagttggaaaagcatattttgagctacaagactacttcaacgct
gactctgtctttactcttgctcatcaaaagtatccttatgctttggaaggaatggatacg
tactccactgttctttatcacctgaaagaagagatgaggttgggctatctggctcaggag
ctgatttctgttgatcgcctgtctccagaatcctggtgtgctgttgggaactgttacagt
ttgcgtaaggatcatgatactgctctcaaaatgtttcagagagctatccaactgaatgaa
agattcacatatgcgcataccctttgtggtcacgagtttgccgcattggaagaatttgag
gatgcagagagatgctaccggaaggctctgggcatagatacaagacactataatgcatgg
tacggtcttggaatgacctatcttcatcgggagaaattcgagtttgcgcagcatcaattt
caactggctctccaaataaatccaagatcttcagtcatcatgtgttactatggaattgct
ttgcatgagtcaaagaggaacgatgaggcgttaatgatgatggagaaggctgtactcact
gatgtgaagaatccgctcccgaagtactacaaagctaccatattaaacagcctcggtgat
tatcacaaagccgttaaagtcttagaagagctcaaagaatgtgctcctcaagagagcagt
gtccatgcgttgcttggcaaaatatacaatcagctaaagcaatacgacaaagccgtgtta
catttcggtattgctttggatttaagcccttctccatctgatgctgtcaagataaagact
tacatggagaggttgatactaccagacgaactggcgacggaggagaatttgtag

DBGET integrated database retrieval system