KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_479356Help
Entry
ARALYDRAFT_479356 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Brite
Enzymes [BR:aly01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     ARALYDRAFT_479356
Protein phosphatases and associated proteins [BR:aly01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ARALYDRAFT_479356
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 552 aa AA seqDB search
MVVETLERSCEGSKRRHVNGGDVAVPCSGDEFSNGDINAAPVVSAKRARVSREMTFQDIY
GADALLNDDDDEEDDCDWEPVQAPVEFVNWCCVNCTMSNPGDMVHCYICGEHKESGILRH
GYLASPFFKDTGLIEVEEKYGGSSSATSSTAVGFDERMLLHSEFEVKPHPHPERPDRLRA
IAASLATAGVFPGRCLPINAREITKQELQMVHTSEHVDAVNTTSQLLYSYFTSDTYANEY
SARAARLAAGLCADLATEIFTGRVKNGFALVRPPGHHAGIRHAMGFCLHNNAAVAALVAQ
AAGAKKVLIVDWDVHHGNGTQEIFEQNKSVLYISLHRHEGGHFYPGTGAADEVGTNGGEG
YCVNVPWSCGGVGDKDYIFAFQHVVLPIASAFSPDFVIISAGFDAARGDPLGCCDVTPAG
YSRMTQMLGDLCGGKMLVILEGGYNLRSISSSATAVIKVLLGEIPENNLPIAATPSREGL
QTVLDVMNIQMKFWPSLAISYSKLLSEWEARLIENKKNQMKRKLVRVPTWWKWGRKKLLY
KFLSGRMISRSK
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggttgtagaaactcttgagaggtcctgtgagggttcaaagagaagacatgtgaatggt
ggtgatgtcgctgttccttgttcgggcgatgagtttagcaatggagatattaatgcagct
cctgtagtttcagcaaaaagagctagggtttctagagaaatgacgtttcaagatatttac
ggtgctgatgcattactgaatgatgatgatgatgaggaggatgattgtgattgggaacct
gtgcaggcgcctgtggagtttgtaaactggtgttgtgttaattgtactatgtcgaaccct
ggtgatatggtccactgttatatatgcggtgaacacaaggaatctggcatcctgaggcat
ggatatttagcgtctcccttttttaaagacactggtctcattgaagtcgaagagaaatat
ggaggaagctcatctgcaaccagctcaacagctgttgggttcgacgagagaatgttgcta
cactcagaatttgaagtgaagccacatccacatccagagagacctgatcgtcttcgagct
atagctgctagtcttgccacagctggtgtttttcctggaagatgcttgcctattaatgca
agggaaatcacgaaacaagaactccagatggtccacacttcagagcatgttgatgctgtt
aatactacaagccagcttctctatagctacttcacctctgacacgtatgctaatgagtat
tcagcacgtgctgctagacttgcagcaggtttgtgcgctgatctagcaacagaaattttc
actggccgtgtaaaaaatggtttcgctttggttagacctccgggtcatcatgctggcatc
aggcatgctatggggttttgccttcacaataatgcagccgttgctgcattagtagcacaa
gcagcaggggcaaagaaggtgctgattgtggactgggatgtacatcatggaaatggaact
caagagatattcgaacaaaacaaatctgtattgtacatatccttgcacagacatgaggga
ggacacttctatcccggtactggagctgctgatgaggttggtacaaatggtggggaaggt
tattgtgtaaatgttccttggagttgcggtggagttggtgataaagactatatctttgca
tttcaacatgtggttcttcccatagcttctgcattttctccagattttgtcatcatatca
gcgggatttgatgctgctagaggagacccattaggatgctgtgatgtgactccggctggc
tattctcgaatgacacagatgttgggtgatctgtgcggtgggaaaatgctagttattctg
gaggggggctacaatcttcgctccatatcttcttctgcaacagcagtgatcaaggtgctt
ctgggtgaaattccggagaataacctgcccatcgcagccacgccttcaagagaaggccta
caaactgttcttgatgtaatgaatattcaaatgaagttctggccatcacttgctatcagc
tactccaaattactctcagagtgggaagcacgtctgatcgaaaacaaaaaaaatcagatg
aaaaggaagcttgttcgggttccgacatggtggaaatggggacgaaagaagcttttgtac
aagtttctctcagggcgtatgatttcaagatcaaaatga

DBGET integrated database retrieval system