KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_479589Help
Entry
ARALYDRAFT_479589 CDS       T01578                                 

Gene name
UBP14
Definition
ubiquitin-specific protease 14
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Brite
Enzymes [BR:aly01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     ARALYDRAFT_479589 (UBP14)
Peptidases [BR:aly01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   ARALYDRAFT_479589 (UBP14)
Exosome [BR:aly04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ARALYDRAFT_479589 (UBP14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 797 aa AA seqDB search
MELLRSNLSRVQIPEPTHRIYKHECCISFDTPRSEGGLFVDMNSFLAFGKDYVSWNYEKT
GNPVYLHIKQTTKSIPEDRPLKKPTLLAIGVDGGFDNNEPEYEESYSIVILPDFVSLPFP
SVELPEKVRIAVDTVVNAVGAERKEQVAAWTAEKKLVSEHALTLQQIKSGIVIPPSGWKC
AKCDKTENLWLNLTDGMILCGRKNWDGTGGNNHAVEHYKETAYPLAVKLGTITADLEAAD
VYSYPEDDSVLDPLLAEHLAHFGIDFSSMQKTEMTTAERELDQNTNFDWNRIQESGKELV
PVFGPGYTGLVNLGNSCYLAATMQIVFSNHSFISRYFSHQSLKMAFEMAPADPTLDLNMQ
LTKLGHGLLSGKYSIPATQKDATTGDARQEGIPPRMFKNVIAASHAEFSSMRQQDALEFF
LHLVGKVERASNTTPDLDPSRSFKFGIEEKILCPSGKVGYNKREDCILSLNIPLHEATNK
DELEAFNKQKAGKGLEENDIRSSDEIVRPRVPLEACLANFASSEAIDDYYSSALKGRTTA
IKTTGLTSFPDYLVLHMRKFVMEAGWVPKKLDVYIDVPDVIDISHMRSKGLQPGEELLPD
GVPEEVIESAQPVANEEIVAQLVSMGFSQLHCQKAAINTSNAGVEEAMNWLLSHMDDPDI
DAPISHQTSDVDQSSLDALLSFGFAEDVARKALKASGGDIEKATDWIFNNPNASVSDMDV
SSSNSAQTPAQSGLPDGGGKYKLFGIVSHMGTSVHCGHYVAHILKEGRWVIFNDDKVGIS
TDPPKDMGYVYFFQRLD
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atggagctcctccgatccaacttgtctagggttcagatccctgaacctactcatcgcatc
tacaagcatgagtgttgcatctccttcgatactccgagatccgaaggaggattgttcgta
gatatgaatagttttcttgcttttgggaaggattatgtttcttggaattatgagaagact
ggaaaccctgtttatctgcatattaagcagaccaccaagtctattcctgaggatcgccct
ctcaagaaaccgactctgctcgctataggagttgatggaggatttgataacaatgagcct
gagtacgaggagtcgtatagcatagtcattcttccggattttgtgtcacttccgtttcct
tctgttgaactaccagagaaggtgaggattgctgtcgatactgtagtgaatgccgtaggt
gctgagcggaaagagcaagttgcagcttggacagctgagaaaaagttagttagtgaacat
gcattgacactgcagcaaatcaagagtggcattgtcattcctccctctggttggaaatgt
gccaagtgtgataagacggagaatctctggcttaatcttaccgatggaatgattctctgt
ggaagaaaaaactgggatggaactggtggaaacaaccatgcggttgagcactacaaagag
acagcctaccctcttgctgtaaagcttggaactatcacagctgacttagaagcagcagat
gtttattcctatccggaagatgacagtgttttggacccgctcctggctgagcatctggcc
cattttggaattgacttttcgtcgatgcagaagactgaaatgacaactgccgaaagagaa
cttgatcaaaatacaaattttgattggaaccgtatacaagagagtggaaaagaattggta
ccagtttttggacctggatataccggacttgttaatcttgggaacagttgctacttggca
gctacgatgcagattgttttctctaaccattcatttatttcaagatacttttcacatcag
agcttaaagatggcttttgagatggctcctgctgatccaactttggacctcaatatgcaa
ttaacaaagcttggacatggtttactatctgggaagtactctattcctgcaactcagaag
gatgctacaactggagatgctagacaagaaggaatacctcctcgcatgttcaaaaacgta
attgctgcgagccacgcagaattctcttctatgagacagcaggatgcgctcgagtttttt
ctccatttggtaggcaaggttgagcgtgctagcaacacgacaccagatttagatccctcg
aggagcttcaagtttggaatagaagagaagatcctttgtccatctggaaaggttggatat
aataagagggaagactgtattctttctttgaacattccgctgcatgaggcaactaataaa
gatgaattagaagcctttaacaagcagaaagcaggaaaaggattggaagaaaatgatatc
aggtcaagtgatgaaatagtacgcccacgagttcctttagaagcttgtctagcaaatttt
gcatcatcagaggcgattgatgactactacagctctgctctgaaggggaggacaacagct
atcaagacaactggtttgacatctttcccagattatttggtcttgcacatgcggaagttt
gttatggaggcaggctgggtgccaaaaaaacttgatgtatacattgatgttccggatgtt
attgatatcagccacatgcgtagcaaaggactccaacctggggaggaactgttgccagat
ggcgttccagaagaagtgattgaatcagcgcagcctgtggcaaatgaggagatagttgca
caacttgtctcaatgggatttagccagcttcattgccagaaagctgccataaatacttcc
aatgctggggttgaagaggcaatgaactggttactttctcacatggatgatccagacatt
gatgcaccgatctcccaccagacatctgacgttgatcaatcaagccttgatgccttactc
tcttttggttttgctgaagatgttgctcgaaaggcactaaaggcctcgggaggagatata
gagaaagcaacagattggatattcaacaaccctaatgcatctgtttcagacatggatgtt
tcctctagcaattcagcgcagactccggctcaaagtggattaccagatggaggagggaaa
tacaagctgtttggaatagtaagtcacatgggaacatcagtgcactgtggtcactacgtg
gcgcacatattgaaagaaggtcgttgggttattttcaatgacgacaaagttggtatctcg
actgatcctcctaaagacatgggttatgtctacttctttcagcggcttgattga

DBGET integrated database retrieval system