KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_479647Help
Entry
ARALYDRAFT_479647 CDS       T01578                                 

Definition
ubiquitin carboxyl-terminal hydrolase 7
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Brite
Enzymes [BR:aly01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     ARALYDRAFT_479647
Peptidases [BR:aly01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   ARALYDRAFT_479647
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 477 aa AA seqDB search
MLTVSVKWQKKVFESIEVDTLQPPYVFKAQLYDLSGVPPERQKIMVKGGLLKDDADWSTL
GLKNGQKLMMMGTADEILKAPENGPVFMEDLPEEEQAANLGYSAGLVNLGNTCYMNSTMQ
CLKSVPELKSELSNYQSARTKDVDQTSHMLTVATRELFSELDKSVKAVAPMPFWMVLQKK
YPQFAQLHNGNHMQQDAEECWTQMLYTLSQSLKPPSPTEDPDAVKALFGLNLRSRLHCQE
SSEESSETESVFSLKCHISHEVNHLHEGLKHGLKGELEKTSPALGRTAVYIKESLIDSLP
RYLTVQFVRFFWKRESNQKAKILRKVDYPLELDVYDLCSEDLRKKLKAPRQKLRDIEGQK
LGLQASAKSSSKGDDVKMTDAEGSSNGSGELSSGDQPGGASSHMTGIYDLVSVLTHKGRS
ADSGHYVSWVKQESGKWVQYDDANTSLQREEDITKLSGGGDWHMAYIVMYKARLISM
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgttaacagtgagcgtgaagtggcaaaagaaggtgtttgagagtatcgaggtcgatact
ctccagcctccttatgttttcaaggctcagttgtatgatttaagtggagtaccgcctgag
cggcaaaagataatggtcaaaggtggacttttgaaggatgatgcagattggtctacgttg
ggactcaaaaatggtcaaaaattgatgatgatgggaactgcagatgaaatactcaaggct
ccagagaatggtcctgtttttatggaggatcttcctgaggaggaacaagccgctaatctg
ggttacagtgctggcctagtcaatcttggaaacacctgctacatgaactcaacgatgcag
tgtttaaaatctgtcccagagttgaaatctgaattatccaattaccaatctgctcgaacc
aaggatgttgatcagacttctcacatgctcacagttgcaacacgtgagttatttagtgag
cttgataaaagtgtcaaggctgttgcgcctatgccattctggatggtgttacaaaaaaaa
tatcctcagtttgctcagttgcataacggaaatcacatgcaacaggatgctgaagaatgt
tggacacaaatgttgtacactctttcccagtccctaaaaccgccatcgcctaccgaagat
cctgatgctgtgaaggctctttttggtctcaaccttcgtagcaggttgcattgccaagaa
agtagtgaagaaagctcggagacagaatctgtcttttctctgaaatgtcacatatcacat
gaggtgaaccacttgcatgaaggattaaaacatggactgaaaggagaacttgaaaaaaca
tctcctgctctgggtcgtacagcggtttacattaaggagtctcttatagattcgttgcca
aggtacctgactgttcagtttgtgagatttttctggaaacgggagagtaatcagaaagca
aaaattctccggaaagtggattatccgttggagttggatgtatatgacctttgttctgag
gatcttcgaaagaaactgaaagctcctcggcagaaactgagagatattgaaggtcaaaag
cttggtctgcaagccagtgcaaagagcagctcaaagggcgatgatgtgaaaatgactgat
gctgagggatcatcaaacggaagtggtgagttatcctccggtgaccaacctggaggtgct
tcgtctcacatgaccggaatttatgacctggtctcagttttgacccacaaaggcagaagc
gcagactctgggcattatgtttcatgggtcaagcaagagagtggtaagtgggttcaatac
gacgatgctaacacgagccttcaacgggaagaggatatcactaaactctctggaggaggt
gattggcatatggcatacatcgtaatgtacaaggcccgtctcatctccatgtaa

DBGET integrated database retrieval system